Recombinant Full Length Aspergillus Oryzae Bifunctional Lycopene Cyclase/Phytoene Synthase(Ao090020000159) Protein, His-Tagged
Cat.No. : | RFL980AF |
Product Overview : | Recombinant Full Length Aspergillus oryzae Bifunctional lycopene cyclase/phytoene synthase(AO090020000159) Protein (Q2U4X9) (1-587aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aspergillus oryzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-587) |
Form : | Lyophilized powder |
AA Sequence : | MGLDYILVHVTYNIPLAGILTLVYWPFMTRLDWQKISTLVIISLVATIPWDSYLVRHRIW TYAPNGVIGWTLYDIPSEEVFFFIIQTYNTSLVYLILTRWLVLPMYLGTVARKETLIGAS ILLLAISVGLIALCFGDHFTYFGMIITWAGPFLLIQWVFSSGFIIALPKLELMVSITLPT LFLWTVDTISINQGTWTVEAPTKLGVQLWSGMDIEEVLFFLITNIVIVFGLVCIDYAIAM ATCELVQSPQAVQSFPSYFRVLARFVTNKYHPDKQFVASLRKAVDRLAASSQSMYMGSAM FQGPFRIDLILLYSFFRVADDLVDESQDTESARMIIEQCDQLLEAKFSHPELFPFSPGYQ EAKHPAPPELIAAIDSLPVSRLRLEHLKGLIEGFRTDLTFSAKPGSFPFVTESDLDTYAY HVASSVAASMLGLVVHHFPDHQFAINVFLRRRVVDAGERMGQTLQYINVARDIARDAAIN RVYLPTTWLKQQGLGPEDVLASPTDSRLELVRDRLLDRAEFLSASAREEMKFLPDEVQGP FLATVDSYLEIGAALRRGMRPRTLDDKLRLPLGTRLWVAYRAMAWRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AO090020000159 |
Synonyms | AO090020000159; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ] |
UniProt ID | Q2U4X9 |
◆ Recombinant Proteins | ||
ADARB2-316H | Recombinant Human ADARB2 Protein, GST-tagged | +Inquiry |
PRKCHA-6630Z | Recombinant Zebrafish PRKCHA | +Inquiry |
RFL25426HF | Recombinant Full Length Human Membrane-Spanning 4-Domains Subfamily A Member 14(Ms4A14) Protein, His-Tagged | +Inquiry |
RFL32450GF | Recombinant Full Length Geobacillus Kaustophilus Cardiolipin Synthase(Cls) Protein, His-Tagged | +Inquiry |
SDHDA-617Z | Recombinant Zebrafish SDHDA | +Inquiry |
◆ Native Proteins | ||
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
IgA-203H | Native Human Immunoglobulin A | +Inquiry |
A1m-367M | Native Mouse A1m | +Inquiry |
Factor Xa-64H | Native Human Factor Xa | +Inquiry |
Peroxidase-32H | Active Native Horseradish Peroxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAC3-1287HCL | Recombinant Human TAC3 293 Cell Lysate | +Inquiry |
RHCE-2358HCL | Recombinant Human RHCE 293 Cell Lysate | +Inquiry |
IFNA2-954CCL | Recombinant Cynomolgus IFNA2 cell lysate | +Inquiry |
RSPH9-253HCL | Recombinant Human RSPH9 cell lysate | +Inquiry |
CPPED1-629HCL | Recombinant Human CPPED1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AO090020000159 Products
Required fields are marked with *
My Review for All AO090020000159 Products
Required fields are marked with *
0
Inquiry Basket