Recombinant Full Length Ashbya Gossypii Serine Palmitoyltransferase-Regulating Protein Tsc3(Tsc3) Protein, His-Tagged
Cat.No. : | RFL21338AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Serine palmitoyltransferase-regulating protein TSC3(TSC3) Protein (Q750C9) (1-107aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-107) |
Form : | Lyophilized powder |
AA Sequence : | MMAADDTMSSKRADNCYKKDRGTMVYTPTDAQQATGKVHEKVYKFFESLYWMYYIHLPYY LMTSFDSFCLHVFFLVVFTLSLFGLLKWVLSLYWATVGYMAYAATGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TSC3 |
Synonyms | TSC3; AGR026C; Serine palmitoyltransferase-regulating protein TSC3 |
UniProt ID | Q750C9 |
◆ Recombinant Proteins | ||
N-353V | Recombinant 2019-nCoV N(D3L, S235F) Protein, His-tagged | +Inquiry |
STAT6-7074Z | Recombinant Zebrafish STAT6 | +Inquiry |
MRPL11-5684M | Recombinant Mouse MRPL11 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL12296MF | Recombinant Full Length Mouse Ceramide Synthase 1(Cers1) Protein, His-Tagged | +Inquiry |
FGFBP2-4842HF | Recombinant Full Length Human FGFBP2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1745S | Active Native Sambucus Nigra Lectin Protein | +Inquiry |
AMY2B-1858H | Native Human Amylase, Alpha 2B (pancreatic) | +Inquiry |
Cry1Ab-523 | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
LDHC-28045TH | Native Human LDHC | +Inquiry |
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
293T-2104H | 293T whole cell lysate | +Inquiry |
MIF4GD-4315HCL | Recombinant Human MIF4GD 293 Cell Lysate | +Inquiry |
APPBP2-100HCL | Recombinant Human APPBP2 cell lysate | +Inquiry |
FBXO40-607HCL | Recombinant Human FBXO40 cell lysate | +Inquiry |
ESRRG-6536HCL | Recombinant Human ESRRG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TSC3 Products
Required fields are marked with *
My Review for All TSC3 Products
Required fields are marked with *
0
Inquiry Basket