Recombinant Full Length Human FGFBP2 Protein, GST-tagged

• Cat.No.: FGFBP2-4842HF
• Product Overview: Human FGFBP2 full-length ORF ( NP_114156.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.[provided by RefSeq Staff
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 51 kDa
• Protein length: 223 amino acids
• AA Sequence: MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FGFBP2 fibroblast growth factor binding protein 2 [ Homo sapiens ]
• Official Symbol: FGFBP2
• Synonyms: FGFBP2; fibroblast growth factor binding protein 2; fibroblast growth factor-binding protein 2; killer specific secretory protein of 37 kDa; KSP37; FGF-BP2; FGFBP-2; HBp17-RP; FGF-binding protein 2; HBp17-related protein; 37 kDa killer-specific secretory protein; killer-specific secretory protein of 37 kDa; HBP17RP
• Gene ID: 83888
• mRNA Refseq: NM_031950
• Protein Refseq: NP_114156
• MIM: 607713
• UniProt ID: Q9BYJ0