Recombinant Full Length Ashbya Gossypii Palmitoyltransferase Pfa5(Pfa5) Protein, His-Tagged
Cat.No. : | RFL6362AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Palmitoyltransferase PFA5(PFA5) Protein (Q75D19) (1-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-359) |
Form : | Lyophilized powder |
AA Sequence : | MWQCKNKSRWWYSLVPILCICIMCYGAIAYSYSFCYVEVWTHLGMKAAAIGMTCLHLIIV ILLWIIWAQIIMMGPGRQPRVAPFMILPEMADAGERAKEGAATSVLPPDVYQCDTQGYPV WCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLMCFLMHALIIF VSVVSLQRRIASSARMRGEREDPNVLVVLSLSCLVLLMVGALFISFLNYMANNQTTIEKL DTPKRQPRTMCFCVYNPADQYRYVVKSLPHENWNMWDKGSAYANYKDFLGSSIWRWFIPI GSNIPEFQTSAWEDDYNAILGPYKEELGSHYRDILMQRIEQGKYVTRLRVYGDKFREGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA5 |
Synonyms | PFA5; ABR203W; Palmitoyltransferase PFA5; Protein fatty acyltransferase 5 |
UniProt ID | Q75D19 |
◆ Recombinant Proteins | ||
CYLD-27021TH | Recombinant Human CYLD | +Inquiry |
NAPEPLD-1136H | Recombinant Human NAPEPLD | +Inquiry |
VVHA-2385V | Recombinant Vibrio Vulnificus VVHA Protein (21-471 aa), His-Myc-tagged | +Inquiry |
WRN-13H | Recombinant Human WRN Protein, non-tagged, Asn500-Gln1229 | +Inquiry |
CLEC10A-3904H | Recombinant Human CLEC10A Protein (Gln61-Asn292), N-Fc tagged | +Inquiry |
◆ Native Proteins | ||
Myosin S1-879R | Native Rabbit Myosin S1 Protein | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
F10-5392M | Active Native Mouse Coagulation Factor X | +Inquiry |
Complement C4b-51H | Native Human Complement C4b | +Inquiry |
LH-839H | Active Native Human Luteinizing Hormone | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAUS8-1242HCL | Recombinant Human HAUS8 cell lysate | +Inquiry |
SDR9C7-2005HCL | Recombinant Human SDR9C7 293 Cell Lysate | +Inquiry |
USP44-455HCL | Recombinant Human USP44 293 Cell Lysate | +Inquiry |
Thymus-580M | MiniPig Thymus Lysate, Total Protein | +Inquiry |
ZMIZ1-154HCL | Recombinant Human ZMIZ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFA5 Products
Required fields are marked with *
My Review for All PFA5 Products
Required fields are marked with *
0
Inquiry Basket