Recombinant Human CYLD

• Cat.No.: CYLD-27021TH
• Product Overview: Recombinant fragment of Human CYLD with N terminal proprietary tag, 36.63kDa.

Specification

• Description: This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Detected in fetal brain, testis, and skeletal muscle, and at a lower level in adult brain, leukocytes, liver, heart, kidney, spleen, ovary and lung. Isoform 2 is found in all tissues except kidney.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
• Sequence Similarities: Belongs to the peptidase C67 family.Contains 3 CAP-Gly domains.
• Tag: Non

Gene Information

• Gene Name: CYLD cylindromatosis (turban tumor syndrome) [ Homo sapiens ]
• Official Symbol: CYLD
• Synonyms: CYLD; cylindromatosis (turban tumor syndrome); CYLD1; ubiquitin carboxyl-terminal hydrolase CYLD; KIAA0849; ubiquitin specific peptidase like 2; USPL2
• Gene ID: 1540
• mRNA Refseq: NM_015247
• Protein Refseq: NP_056062
• MIM: 605018
• Uniprot ID: Q9NQC7
• Chromosome Location: 16q12-q13
• Pathway: Canonical NF-kappaB pathway, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; NOD1/2 Signaling Pathway, organism-specific biosystem; Negative regulators of RIG-I/MDA5 signaling, organism-specific biosystem
• Function: cysteine-type peptidase activity; metal ion binding; peptidase activity; proline-rich region binding; protein binding