Recombinant Full Length Ashbya Gossypii Nuclear Fusion Protein Kar5(Kar5) Protein, His-Tagged
Cat.No. : | RFL36719AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Nuclear fusion protein KAR5(KAR5) Protein (Q759Y0) (20-478aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-478) |
Form : | Lyophilized powder |
AA Sequence : | EITHVVSHLAETALRQDTNFQLLSQDIIAKKFPILDSSCVRRALSDFLPQCLQYGFETVP SDVRTQAAVKLSICELQASGVDNMPPECVGAVHFGACLRAMERTPQWWTTYSGNYQHLPS TCFENALPYEKEQLLSLFLNITDVYSNFQDDLVVDLEKYRANFEATVEASLRLMKASLME GTHEIVNQLKDDLNYVNSKLADMGKTITEHTDNVRTVFNDISDELNDYDMAGQIAHLKED TMSLWQKINSDMGTYRDVQMSSLYNINAVFDTFYNRATESVQQVRTSVIESQLETLDLIA DFNSLVRKSILPVLADELQPQLQEMSVSISRSLVGLSASYNEHLQAWSNRVNETLSEMES HLNNAMSQVEHMNDSIETLENKVFVLVSLGNALTTYVKWIYTFSRALISGYGIVTLIMSM LVVRYSIKLNSSWIKVLGRSTFILVAVVLGARTGSMLSY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KAR5 |
Synonyms | KAR5; ADR143W; Nuclear fusion protein KAR5; Karyogamy protein 5 |
UniProt ID | Q759Y0 |
◆ Recombinant Proteins | ||
CXXC5-1357R | Recombinant Rat CXXC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gipr-5643R | Recombinant Rat Gipr protein, His-tagged | +Inquiry |
IL13RA2-6368Z | Recombinant Zebrafish IL13RA2 | +Inquiry |
SMA5A-3511H | Active Recombinant Human SEMA5A, MIgG2a Fc-tagged | +Inquiry |
Hmgcs1-3414M | Recombinant Mouse Hmgcs1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
CVF-01I | Native purified cobra venom factor | +Inquiry |
Fgb-64R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
FSH-1565S | Active Native Sheep Stimulating Hormone | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEMA4A-2066HCL | Recombinant Human SEMA4A cell lysate | +Inquiry |
DENND5A-1456HCL | Recombinant Human DENND5A cell lysate | +Inquiry |
RAB6B-2585HCL | Recombinant Human RAB6B 293 Cell Lysate | +Inquiry |
PTPN2-533MCL | Recombinant Mouse PTPN2 cell lysate | +Inquiry |
CD84-1733MCL | Recombinant Mouse CD84 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KAR5 Products
Required fields are marked with *
My Review for All KAR5 Products
Required fields are marked with *
0
Inquiry Basket