Recombinant Full Length Saccharomyces Cerevisiae Nuclear Fusion Protein Kar5(Kar5) Protein, His-Tagged
Cat.No. : | RFL35352SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Nuclear fusion protein KAR5(KAR5) Protein (Q04746) (20-504aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-504) |
Form : | Lyophilized powder |
AA Sequence : | SELGKINNLLQGRLIYTDNSVATNVLESKFPFLKSTCVKDALKLFLPQCIANGLESIDAE TRVETAIKLSICEFQASGLGEIPENCMVDDLGSMMDCMFELESSSQWWTTYSGNYQRLSS ICYENLLPFEKEQILKLFLNITELYDSFGDDVDTKLNHLMFQMEQDSQNFLDDLARMFRN YDNELRNATESNRIILENDLSFFRNKVNDVLYETSEQLEVQIIEKNSQLMNEVDTVHHIM SDLADELAKNDIKSKINDLKDDSLNNLQDLVEMSNDVKEYYSRNNKLVNTELENFSMGLK KQLGGMSKDLSESQMEAIELLQGFNSILHDSLLPSMTDEIVPEMTNFKNTLLQEWTAITS TLNGDFALWNEEIFSTFNDISEKLNGTKKKLDDIEIRVSLVHKNVMTMMRVLDFMWKTSK MIIRCGYLAVKNKYYWLLCSVVWIWSKYRTSRVNVKMIPIKRYYQWAALLLSIYLGAKTG SLIDF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KAR5 |
Synonyms | KAR5; FIG3; YMR065W; YM9916.04; Nuclear fusion protein KAR5; Factor-induced gene 3 protein; Karyogamy protein 5 |
UniProt ID | Q04746 |
◆ Native Proteins | ||
HB-42P | Native Pig Hemoglobin (HB) Protein | +Inquiry |
A2M-01H | Native Human A2M Protein | +Inquiry |
Cs-164P | Active Native Porcine Citrate Synthase | +Inquiry |
MDH-38P | Active Native Porcine Malate dehydrogenase | +Inquiry |
IgA-249P | Native Pig Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF232-112HCL | Recombinant Human ZNF232 293 Cell Lysate | +Inquiry |
Ovary-350H | Human Ovary Cytoplasmic Lysate | +Inquiry |
FAM53C-6369HCL | Recombinant Human FAM53C 293 Cell Lysate | +Inquiry |
BTN2A1-8389HCL | Recombinant Human BTN2A1 293 Cell Lysate | +Inquiry |
IFI27-5296HCL | Recombinant Human IFI27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KAR5 Products
Required fields are marked with *
My Review for All KAR5 Products
Required fields are marked with *
0
Inquiry Basket