Recombinant Full Length Ashbya Gossypii Microsomal Signal Peptidase Subunit 1(Spc1) Protein, His-Tagged
Cat.No. : | RFL3152AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Microsomal signal peptidase subunit 1(SPC1) Protein (Q74Z81) (1-91aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-91) |
Form : | Lyophilized powder |
AA Sequence : | MEIFNDLSRKLVFPIDYPSQRRVAKLTDIILGSGTLVSCLLGFYAGSLSLTLYAFAAAYG LALLLVVPAYGKYRQQKLAWVGSAAATTKDL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPC1 |
Synonyms | SPC1; AGR325C; Microsomal signal peptidase subunit 1 |
UniProt ID | Q74Z81 |
◆ Recombinant Proteins | ||
Il22ra2-6743M | Recombinant Mouse Il22ra2 Protein (Full Length), C-His tagged | +Inquiry |
Ostn-770M | Recombinant Mouse Ostn Protein, His/GST-tagged | +Inquiry |
LILRB2-4474H | Recombinant Human LILRB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IMPACT-4532M | Recombinant Mouse IMPACT Protein, His (Fc)-Avi-tagged | +Inquiry |
SH-RS07560-5556S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS07560 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LDH5-225H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
Chylomicrons-192H | Native Human Chylomicrons | +Inquiry |
HP-193S | Native Swine Haptoglobin | +Inquiry |
GDF15-27680TH | Active Native Human GDF15 Protein | +Inquiry |
GC-198H | Native Human GC-Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD38-1259RCL | Recombinant Rat CD38 cell lysate | +Inquiry |
OTP-3517HCL | Recombinant Human OTP 293 Cell Lysate | +Inquiry |
EIF2D-541HCL | Recombinant Human EIF2D cell lysate | +Inquiry |
MRPS12-4152HCL | Recombinant Human MRPS12 293 Cell Lysate | +Inquiry |
Fetus-188M | Mouse Fetus (17 Day Fetus) Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPC1 Products
Required fields are marked with *
My Review for All SPC1 Products
Required fields are marked with *
0
Inquiry Basket