Recombinant Full Length Ashbya Gossypii Erad-Associated E3 Ubiquitin-Protein Ligase Hrd1(Hrd1) Protein, His-Tagged
Cat.No. : | RFL25216AF |
Product Overview : | Recombinant Full Length Ashbya gossypii ERAD-associated E3 ubiquitin-protein ligase HRD1(HRD1) Protein (Q75CC8) (1-575aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-575) |
Form : | Lyophilized powder |
AA Sequence : | MPREVSWPMWAMFITATYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYC LFVWAIIRVLFGQLTAIEYDHIFERLHVVLVTLASIVITMRKTYMAGHMTILFYTLCLVA HWVLRDRMDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQNTNVDGKRHEL YLMLALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSANLVYEGGTTDDDADDEVFILEG KYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFVRSIKAGESFLLVYNYWKNNKK LYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMER SQTCPICRLSVFANDSNSHATTQAREQTPPDLLQERGIDEHIDVIGMQDMSVQSISLHEG TAVRRGTTGNCMNQAYDGGLLSHEERDQAGWVAFPIEFRADNKVFFNLNDSQGDRQWMAS YTSYPRQNMVNSDDPDNASESHSRIPSPSLPGSLEGTSSQVDVTVSAKDAPANACFVIAT SKLEQTKEVEHLKRKVEELESRVEELSKRIKTDQV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HRD1 |
Synonyms | HRD1; ACL019C; ERAD-associated E3 ubiquitin-protein ligase HRD1; RING-type E3 ubiquitin transferase HRD1 |
UniProt ID | Q75CC8 |
◆ Recombinant Proteins | ||
RFL8466EF | Recombinant Full Length Escherichia Coli O9:H4 Nadh-Quinone Oxidoreductase Subunit A(Nuoa) Protein, His-Tagged | +Inquiry |
PA3535-57P | Recombinant Pseudomonas aeruginosa PA3535 Protein | +Inquiry |
LMNA-1304H | Recombinant Human LMNA Protein, His (Fc)-Avi-tagged | +Inquiry |
STRA13-5667C | Recombinant Chicken STRA13 | +Inquiry |
Il24-181M | Recombinant Active Mouse IL24 Protein, His-tagged(C-ter) | +Inquiry |
◆ Native Proteins | ||
TTR-141S | Native Sheep prealbumin | +Inquiry |
Lectin-1814P | Active Native Peanut Lectin Protein, Cy3 labeled | +Inquiry |
GALT-10 | Active Native Streptoverticillium mobaraense | +Inquiry |
IgG-165R | Native Rabbit IgG Fc fragment | +Inquiry |
HP-192F | Native Feline Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEPH1-414HCL | Recombinant Human VEPH1 293 Cell Lysate | +Inquiry |
CLCN7-7472HCL | Recombinant Human CLCN7 293 Cell Lysate | +Inquiry |
AHSA2-8960HCL | Recombinant Human AHSA2 293 Cell Lysate | +Inquiry |
PAGE2-467HCL | Recombinant Human PAGE2 lysate | +Inquiry |
MDA-MD-435S-01HL | MDA-MD-435S Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HRD1 Products
Required fields are marked with *
My Review for All HRD1 Products
Required fields are marked with *
0
Inquiry Basket