Recombinant Full Length Ashbya Gossypii Diacylglycerol O-Acyltransferase 1(Dga1) Protein, His-Tagged
Cat.No. : | RFL15151AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Diacylglycerol O-acyltransferase 1(DGA1) Protein (Q75BY0) (1-461aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-461) |
Form : | Lyophilized powder |
AA Sequence : | MQDSMDDSLREAEGRQDDSEVSSGTTLGSSTPEDSGVTAKLRKKYQMASALLRRELEELS VYDAKTAGVSGRSSGSGSGGLALLGGRFHVAPLRIPARRRLQTLVVAWHTSSFIYMTVLV LFLAANPLMWWFMVPYMVYYVWNRSPANGGVVRRYSPRLRSLALWRYYCEYYPISLHKSE DLAPTFVPDPRGAEPREWKLRLWLWPTRVELLNLTLQWTRARPQVATGPRYIFGYHPHGV GALGAFGAIATEGCNWSKVFAGIPACLCTLVNQFQIPIYRDYLLGLGCTSVARKNVLKVL EQNYSVCIVVGGAQEALLSRVGSTELVLNKRKGFIKLALETGNVNLVPIYAFGETDCFNV LDTGNESYLRKFQLWIKKTYGFTIPFFFARGVFNYDFGFLPFRNPINVVVGKPVYVDKRR TNPTMEEIDHYHDLYVQELRNVFDKNKHKFGYAGKELKIVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DGA1 |
Synonyms | DGA1; ACR140C; Diacylglycerol O-acyltransferase 1 |
UniProt ID | Q75BY0 |
◆ Recombinant Proteins | ||
RBP4-219H | Recombinant Human RBP4 Protein, His-tagged | +Inquiry |
RFL28839EF | Recombinant Full Length Putrescine Transport System Permease Protein Poti(Poti) Protein, His-Tagged | +Inquiry |
HSD17B1-2152R | Recombinant Rhesus monkey HSD17B1 Protein, His-tagged | +Inquiry |
FAM110A-3673H | Recombinant Human FAM110A Protein, GST-tagged | +Inquiry |
VEZF1-039H | Recombinant Human VEZF1 Protein, HIS-tagged | +Inquiry |
◆ Native Proteins | ||
AMY1A-8023H | Native Human Salivary Amylase (Alpha) | +Inquiry |
FTH1-1868H | Native Human Ferritin, Heavy Polypeptide 1 | +Inquiry |
NEFH-180B | Native bovine NEFH | +Inquiry |
FGG -57R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
PLAT-30946TH | Native Human PLAT | +Inquiry |
◆ Cell & Tissue Lysates | ||
NXT1-3618HCL | Recombinant Human NXT1 293 Cell Lysate | +Inquiry |
CNPY4-1284HCL | Recombinant Human CNPY4 cell lysate | +Inquiry |
LAYN-735RCL | Recombinant Rat LAYN cell lysate | +Inquiry |
TNFRSF13B-1916HCL | Recombinant Human TNFRSF13B cell lysate | +Inquiry |
ZFAND5-185HCL | Recombinant Human ZFAND5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DGA1 Products
Required fields are marked with *
My Review for All DGA1 Products
Required fields are marked with *
0
Inquiry Basket