Recombinant Full Length Putrescine Transport System Permease Protein Poti(Poti) Protein, His-Tagged
Cat.No. : | RFL28839EF |
Product Overview : | Recombinant Full Length Putrescine transport system permease protein PotI(potI) Protein (P0AFL2) (1-281aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-281) |
Form : | Lyophilized powder |
AA Sequence : | MNNLPVVRSPWRIVILLLGFTFLYAPMLMLVIYSFNSSKLVTVWAGWSTRWYGELLRDDA MMSAVGLSLTIAACAATAAAILGTIAAVVLVRFGRFRGSNGFAFMITAPLVMPDVITGLS LLLLFVALAHAIGWPADRGMLTIWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGAT PLKVFFVITLPMIMPAIISGWLLAFTLSLDDLVIASFVSGPGATTLPMLVFSSVRMGVNP EINALATLILGAVGIVGFIAWYLMARAEKQRIRDIQRARRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | potI |
Synonyms | potI; c0990; Putrescine transport system permease protein PotI |
UniProt ID | P0AFL2 |
◆ Recombinant Proteins | ||
LIX1L-3077R | Recombinant Rat LIX1L Protein, His (Fc)-Avi-tagged | +Inquiry |
RUVB-3664S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 RUVB protein, His-tagged | +Inquiry |
SERBP1-5330R | Recombinant Rat SERBP1 Protein | +Inquiry |
BTG3-1740Z | Recombinant Zebrafish BTG3 | +Inquiry |
ATP5C1-10396Z | Recombinant Zebrafish ATP5C1 | +Inquiry |
◆ Native Proteins | ||
VLDL-392H | Native Human Very Low Density Lipoprotein | +Inquiry |
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
ALPP-8005H | Native Human Placental Alkaline Phosphatase | +Inquiry |
SNCA-27345TH | Native Human SNCA | +Inquiry |
TNNI3-221H | Native Human TNNI3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2345HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
TMX2-899HCL | Recombinant Human TMX2 293 Cell Lysate | +Inquiry |
BCL3-8481HCL | Recombinant Human BCL3 293 Cell Lysate | +Inquiry |
OAZ3-1243HCL | Recombinant Human OAZ3 cell lysate | +Inquiry |
HAAO-5650HCL | Recombinant Human HAAO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All potI Products
Required fields are marked with *
My Review for All potI Products
Required fields are marked with *
0
Inquiry Basket