Recombinant Full Length Ashbya Gossypii Autophagy-Related Protein 32(Atg32) Protein, His-Tagged
Cat.No. : | RFL26466AF |
Product Overview : | Recombinant Full Length Ashbya gossypii Autophagy-related protein 32(ATG32) Protein (Q753M9) (1-452aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ashbya gossypii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-452) |
Form : | Lyophilized powder |
AA Sequence : | MSTKSQVTRRVRTSIATPEDGVHGNNQHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMT VGKRRVERSLHHSISESWQAIKRSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEMRPS AHGTVHLGSSLASPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEP QLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDG LCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNHHEKHRLLKHLHNL CNESESGYETELTVKSKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGIGCCISLMATTR FTFFSSAPLPLTAVIPAQIPSSVASDKPPHRLVPHFYMLCKTTIRQLGTSLRLFFFEKFE SRTWVHIFGMDLHSDDPLASLGRLMPLDFIML |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATG32 |
Synonyms | ATG32; AFR283W; Autophagy-related protein 32 |
UniProt ID | Q753M9 |
◆ Recombinant Proteins | ||
CHAF1A-1203H | Recombinant Human CHAF1A Protein, GST-Tagged | +Inquiry |
DNASE1L3L-540Z | Recombinant Zebrafish DNASE1L3L | +Inquiry |
KRAS-02H | Recombinant Human KRAS (G12D) Protein, His-tagged | +Inquiry |
NOSTRIN-1078H | Recombinant Human NOSTRIN Protein, His-tagged | +Inquiry |
Cas12a-03L | LbaCas12a Nuclease | +Inquiry |
◆ Native Proteins | ||
FTL-673H | Native Human Ferritin, Light Polypeptide | +Inquiry |
ALB-37G | Native Goat Albumin (ALB) Protein | +Inquiry |
Complement C1-42H | Native Human Complement C1 | +Inquiry |
Lectin-1770D | Active Native Dolichos Biflorus Lectin Protein, Fluorescein labeled | +Inquiry |
Prothrombin-59H | Native Human Prothrombin Frag 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD300A-1809MCL | Recombinant Mouse CD300A cell lysate | +Inquiry |
DLL1-2461HCL | Recombinant Human DLL1 cell lysate | +Inquiry |
Tonsil-535C | Cynomolgus monkey Tonsil Lysate | +Inquiry |
SELT-1982HCL | Recombinant Human SELT 293 Cell Lysate | +Inquiry |
IL1RAPL2-2913HCL | Recombinant Human IL1RAPL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG32 Products
Required fields are marked with *
My Review for All ATG32 Products
Required fields are marked with *
0
Inquiry Basket