Recombinant Human CHAF1A Protein, GST-Tagged

• Cat.No.: CHAF1A-1203H
• Product Overview: Human CHAF1A partial ORF (AAH67093, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Chromatin assembly factor I (CAF1) is a nuclear complex consisting of p50, p60 (CHAF1B; MIM 601245), and p150 (CHAF1A) subunits that assembles histone octamers onto replicating DNA in vitro (Kaufman et al., 1995 [PubMed 7600578]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 36.63 kDa
• AA Sequence: CKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHAF1A chromatin assembly factor 1, subunit A (p150) [ Homo sapiens ]
• Official Symbol: CHAF1A
• Synonyms: CHAF1A; chromatin assembly factor 1, subunit A (p150); chromatin assembly factor 1 subunit A; CAF 1; CAF1; CAF1B; CAF1P150; chromatin assembly factor I (150 kDa); MGC71229; P150; hp150; CAF-I p150; CAF-1 subunit A; CAF-I 150 kDa subunit; chromatin assembly factor I p150 subunit; CAF-1
• Gene ID: 10036
• mRNA Refseq: NM_005483
• Protein Refseq: NP_005474
• MIM: 601246
• UniProt ID: Q13111