Recombinant Full Length Arabidopsis Thaliana Wpp Domain-Interacting Tail-Anchored Protein 2(Wit2) Protein, His-Tagged
Cat.No. : | RFL1976AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana WPP domain-interacting tail-anchored protein 2(WIT2) Protein (A8MQR0) (1-627aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-627) |
Form : | Lyophilized powder |
AA Sequence : | MEEIIREDYFEALSSRNEEEQEMLRMLTKLEIDSAYTSEKLMNLHVLLMHLLAWDNDLEG MGTLDSSPASFEKALTFDLLCGILESEVKEVDEVLDVLEAQIVDTSYKISSCKHGNYIVI EGKLGESAESLKQSRGQVSEITLQLAQLRRTLHYIRNGTSENEESVELRQKYALKPSDLR HKNALRMLEKSLSRELELEKKLMEFQQNEEQLKLKLHYTEEVSSRMEEASEFIWGRFLEA DNSSEVLTGISKELVGRLQILQFSLNGSAQRESELKSKLEDCTVQLEAKDLLVQKLEGTI SENSEIVSEVLTLREYVKSAEQKLKNTDLELKSVNASKQEILVHLAEMENANESVKENLF EAESRAESGEAKIKELDAANLELTEELNFLKDADDKKTKKVNSLEKQVRELEVQVQNSKV SSEANQEQQNMLYSAIWDMETLIEDLKSKASKAESRTETVEEQCIVLSTTNSELNKDVSF LRQKAKSLEAMLDLANNEKERYAQEITTRNKVLMDMMLQLSSERERIQEQLYSLAKENKI LRVNQCSNTYQRNGSYAGDKELSFHADGHEIEALAESLQEDERTREEPEKQSVSEKSSEI RRAIKLKHILVVALVFVLFCSFFGVTY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | WIT2 |
Synonyms | WIT2; At1g68910; T6L1.9; WPP domain-interacting tail-anchored protein 2 |
UniProt ID | A8MQR0 |
◆ Recombinant Proteins | ||
PDCD1-191HAF647 | Active Recombinant Human PDCD1 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
ISG15-191H | Recombinant Human ISG15 protein(Met1-Gly157) | +Inquiry |
Enpep-7834R | Recombinant Rat Enpep protein, His & T7-tagged | +Inquiry |
HEXA-7593M | Recombinant Mouse HEXA Protein | +Inquiry |
Efnb2-131M | Recombinant Mouse Efnb2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MuV-03 | Native Mumps/Parotitis Virus Antigen | +Inquiry |
PerCP-02D | Native Dinophyceae sp. PerCP Protein | +Inquiry |
Lectin-1786G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein | +Inquiry |
ASO-153H | Active Native Human Antistreptolysin O | +Inquiry |
CGB-1850H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
KAT8-1162HCL | Recombinant Human KAT8 cell lysate | +Inquiry |
CSDC2-7250HCL | Recombinant Human CSDC2 293 Cell Lysate | +Inquiry |
HLA-DMB-5500HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
TRMT6-342HCL | Recombinant Human TRMT6 cell lysate | +Inquiry |
C19orf73-8195HCL | Recombinant Human C19orf73 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WIT2 Products
Required fields are marked with *
My Review for All WIT2 Products
Required fields are marked with *
0
Inquiry Basket