Recombinant Full Length Arabidopsis Thaliana Wpp Domain-Interacting Protein 3(Wip3) Protein, His-Tagged
Cat.No. : | RFL25266AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana WPP domain-interacting protein 3(WIP3) Protein (Q94AV5) (1-459aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-459) |
Form : | Lyophilized powder |
AA Sequence : | MNESVPDSVEDNGNSVPANGLLVLPDNDHEEGGVGSPQRSNSVESPGGSVHSTRKGFGLK KWRRIKRDGPVRDEAAPVDDGSKLLKRGLAGLVNPPSKHVEFSSVEARQSSEGSVGSVNM VHHPGVANGFSPDIGCMFAVGQAFEKSEEHSGNTIGGKNVVGGKVVSGSQEKLWSDTIKR ASEERGDIEKEKPCSSLDSDLRSSDFVFSTGSVSVGNHGEKDERLTMNYIGGFSNEGQVK EEVQTYSRSENGNKEDDGESKKNNNHWADKDALADSIRSFAVLQEVLWKEVQSFQELGKE SVLLHSNTDELSSDQPSHQNCKEDNSTSSGSKALILKEKVKLLEHKLEEARAALEAKEAR IQELENSKIESELECIFQRKIETEIEHLMLTRSLSSLQVLQETKKLHSLKEDPVSNRGNI LGKTCKLGFYILTQLILLVSILRFLVLQFSPASRLVIPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | WIP3 |
Synonyms | WIP3; At3g13360; MDC11.15; WPP domain-interacting protein 3 |
UniProt ID | Q94AV5 |
◆ Recombinant Proteins | ||
CDK4-962R | Recombinant Rat CDK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
MX2-2797H | Recombinant Human MX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UBXN10-4896R | Recombinant Rhesus Macaque UBXN10 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDPN-1897H | Active Recombinant Human PDPN protein, Fc-tagged | +Inquiry |
B3GALT5-2474H | Recombinant Human B3GALT5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
TOD-43 | Active Native Tyramine Oxidase | +Inquiry |
GPX1-8429H | Native Human GPX1 | +Inquiry |
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
LDH4-23H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
IgG-166R | Native Rat IgG Fc fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2660HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
Ramos-060HCL | Human Ramos Cell Nuclear Extract | +Inquiry |
PROC-852HCL | Recombinant Human PROC cell lysate | +Inquiry |
CRYBB1-7262HCL | Recombinant Human CRYBB1 293 Cell Lysate | +Inquiry |
ZBED2-1949HCL | Recombinant Human ZBED2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WIP3 Products
Required fields are marked with *
My Review for All WIP3 Products
Required fields are marked with *
0
Inquiry Basket