Recombinant Full Length Arabidopsis Thaliana Wpp Domain-Interacting Protein 1(Wip1) Protein, His-Tagged
Cat.No. : | RFL8052AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana WPP domain-interacting protein 1(WIP1) Protein (Q8GXA4) (1-489aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-489) |
Form : | Lyophilized powder |
AA Sequence : | MDLESESSALESVDDNVLIQQSASNVCDDGRSLDNGSCSDESVKLLSTSNSVELGKPMSF DSPGDGGGAYSPVLKGQGLRKWRRIRRDLVKDTSANMENSKALKRGLSGVAHSHGKQMQF QSPEVEQESQGSVGSVNMLKSSGDGFDILGSSGYDSRFVAGVGFSAGMDLEIDDDRSSKS STVARAPKVIRYEKPMISSGQGGNIRVENSKKHRGESVDFEKENSYSSLESDSRKQSGRM MDYNGENGETSMRKDDAGGEGGESINTDNRYSDEMDPLTEAINGFLALQDALEKEVQQFQ EIGNEPMPQHHEQVSEANSPHPEIVTLVNNVEQLENMLEETRSMLEVKESHIRDLESTTN QSKHSWGGTEIVVEDIFRQKIEAEIEYLIYSRSIDNLNSQMKLIDEQESLAEEQTHETLN KLGRVQTKAANFTNRAQDLQNDCIEITGTIKKRACKITSYVLIQLVLLSTVVLLLLSQLL PEPDTVVPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | WIP1 |
Synonyms | WIP1; At4g26455; M3E9.120; WPP domain-interacting protein 1 |
UniProt ID | Q8GXA4 |
◆ Recombinant Proteins | ||
TMEM43-5827R | Recombinant Rat TMEM43 Protein, His (Fc)-Avi-tagged | +Inquiry |
HNRNPH1-1202H | Recombinant Human HNRNPH1 Protein (2-216 aa), GST-tagged | +Inquiry |
NEURL-2125C | Recombinant Chicken NEURL | +Inquiry |
PPIL2-6985M | Recombinant Mouse PPIL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL13261RF | Recombinant Full Length Rat Claudin-5(Cldn5) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
DNase-24B | Active Native Bovine Deoxyribonuclease | +Inquiry |
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
IgG-7439M | Native Mouse IgG Fc Protein | +Inquiry |
C3-147C | Active Native Botulinum C3 Enzyme | +Inquiry |
Pectin-008A | Native Apple or Citrus fruits Pectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYZL2-001HCL | Recombinant Human LYZL2 cell lysate | +Inquiry |
SLC33A1-1629HCL | Recombinant Human SLC33A1 cell lysate | +Inquiry |
EDAR-2247HCL | Recombinant Human EDAR cell lysate | +Inquiry |
ASPRV1-8641HCL | Recombinant Human ASPRV1 293 Cell Lysate | +Inquiry |
FAM100A-6464HCL | Recombinant Human FAM100A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WIP1 Products
Required fields are marked with *
My Review for All WIP1 Products
Required fields are marked with *
0
Inquiry Basket