Recombinant Full Length Arabidopsis Thaliana Uncharacterized Protein At5G49945(At5G49945) Protein, His-Tagged
Cat.No. : | RFL34374AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Uncharacterized protein At5g49945(At5g49945) Protein (Q94CC0) (22-480aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (22-480) |
Form : | Lyophilized powder |
AA Sequence : | SPFEGFDAEEDDVTDDSSHLLHHSLPPPLLTQSHSSLSDPDPEPEPSSAECKSDLITESD LEHQSDSKTPSSTPFEYWDEDEFEGLPVEIETLESPLITENGTHADPKTPDLKTSSEAQG DTNDQTKKKKSYAVEIACVCFLIALAINYFVGKRENESLALAWAAKFASKDTIFQKNFSM LGVSELEDSPLLLKEALNVFKFYASGRRYCHGLLATMELKSRHDLISRVFNLVVPCKDEI TFEVYMNEETMDHVVFAMTKKKAAKTMQKEMRDLQRFAGIVSPPAGRKWVSEEFALISES KEVAADLITDTVLDQVFGDKAVDKYGKNFMSMHISDQHPGKHKKMMLFKFSLPDAKHMDD IVRLVALIPYYIDLVGRYRLSSQARNKTESGRQKAAEEAYKELHNARQEALQKKKAEKKK MMEEAEAKMSAEVIRKKEAKERARQVKKAVPKMKMSRSH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At5g49945 |
Synonyms | At5g49945; K9P8; Uncharacterized protein At5g49945 |
UniProt ID | Q94CC0 |
◆ Recombinant Proteins | ||
ATPIF1B-3980Z | Recombinant Zebrafish ATPIF1B | +Inquiry |
RFL33968AF | Recombinant Full Length Albinaria Coerulea Nadh-Ubiquinone Oxidoreductase Chain 3(Nd3) Protein, His-Tagged | +Inquiry |
CCDC120-2769H | Recombinant Human CCDC120 Protein, MYC/DDK-tagged | +Inquiry |
RFL21002SF | Recombinant Full Length Synechococcus Sp. Cytochrome B6-F Complex Subunit 4(Petd) Protein, His-Tagged | +Inquiry |
MRPL34-1091H | Recombinant Human MRPL34 | +Inquiry |
◆ Native Proteins | ||
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
IgA-238R | Native Rabbit Immunoglobulin A | +Inquiry |
AMY1A-8022H | Native Human Salivary Amylase | +Inquiry |
TNNI3-223H | Native Human Troponin I Type 3 (Cardiac) | +Inquiry |
Lectin-1750M | Active Native Maackia Amurensis Lectin II Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC4D-1487RCL | Recombinant Rat CLEC4D cell lysate | +Inquiry |
LPCAT1-4672HCL | Recombinant Human LPCAT1 293 Cell Lysate | +Inquiry |
SLC5A6-1708HCL | Recombinant Human SLC5A6 293 Cell Lysate | +Inquiry |
MAN1C1-1051HCL | Recombinant Human MAN1C1 cell lysate | +Inquiry |
TGDS-1122HCL | Recombinant Human TGDS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All At5g49945 Products
Required fields are marked with *
My Review for All At5g49945 Products
Required fields are marked with *
0
Inquiry Basket