Recombinant Full Length Arabidopsis Thaliana Udp-Glucuronate:Xylan Alpha-Glucuronosyltransferase 1(Gux1) Protein, His-Tagged
Cat.No. : | RFL6584AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana UDP-glucuronate:xylan alpha-glucuronosyltransferase 1(GUX1) Protein (Q9LSB1) (1-659aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-659) |
Form : | Lyophilized powder |
AA Sequence : | MANSPAAPAPTTTTGGDSRRRLSASIEAICKRRFRRNSKGGGRSDMVKPFNIINFSTQDK NSSCCCFTKFQIVKLLLFILLSATLFTIIYSPEAYHHSLSHSSSRWIWRRQDPRYFSDLD INWDDVTKTLENIEEGRTIGVLNFDSNEIQRWREVSKSKDNGDEEKVVVLNLDYADKNVT WDALYPEWIDEEQETEVPVCPNIPNIKVPTRRLDLIVVKLPCRKEGNWSRDVGRLHLQLA AATVAASAKGFFRGHVFFVSRCFPIPNLFRCKDLVSRRGDVWLYKPNLDTLRDKLQLPVG SCELSLPLGIQDRPSLGNPKREAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDD NISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWNYSKFRLWQLTDYDKIIFIDADLL ILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCTFQLLMEHINEIESYNGGDQGYLN EVFTWWHRIPKHMNFLKHFWIGDEDDAKRKKTELFGAEPPVLYVLHYLGMKPWLCYRDYD CNFNSDIFVEFATDIAHRKWWMVHDAMPQELHQFCYLRSKQKAQLEYDRRQAEAANYADG HWKIRVKDPRFKICIDKLCNWKSMLRHWGESNWTDYESFVPTPPAITVDRRSSLPGHNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GUX1 |
Synonyms | GUX1; PGSIP1; At3g18660; MVE11.2; UDP-glucuronate:xylan alpha-glucuronosyltransferase 1; UDP-GlcA:xylan glucuronyltransferase 1; Glycogenin-like protein 1; Plant glycogenin-like starch initiation protein 1; Protein GLUCURONIC ACID SUBSTITUTION OF XYLAN 1; |
UniProt ID | Q9LSB1 |
◆ Recombinant Proteins | ||
ZGLP1-4394Z | Recombinant Zebrafish ZGLP1 | +Inquiry |
MAP1LC3A-2660R | Recombinant Rhesus monkey MAP1LC3A Protein, His-tagged | +Inquiry |
XCL1-160H | Active Recombinant Human XCL1, MIgG2a Fc-tagged | +Inquiry |
Hfe-4300M | Recombinant Mouse Hfe Full Length Transmembrane protein, His-tagged | +Inquiry |
RPLP0-9122Z | Recombinant Zebrafish RPLP0 | +Inquiry |
◆ Native Proteins | ||
FABP-174M | Native Cynomolgus Monkey Fatty acid Binding Protein | +Inquiry |
Lectin-1787G | Active Native Griffonia Simplicifolia Lectin II Protein, Agarose bound | +Inquiry |
F13A1-5399H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
ACPP-29981TH | Native Human ACPP | +Inquiry |
Mb-8232R | Native Rat Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYPD6B-397HCL | Recombinant Human LYPD6B lysate | +Inquiry |
CMTM8-190HCL | Recombinant Human CMTM8 lysate | +Inquiry |
RAB41-2591HCL | Recombinant Human RAB41 293 Cell Lysate | +Inquiry |
Y-79-1942H | Y-79 (human retinoblastoma) nuclear extract lysate | +Inquiry |
KCNK12-948HCL | Recombinant Human KCNK12 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GUX1 Products
Required fields are marked with *
My Review for All GUX1 Products
Required fields are marked with *
0
Inquiry Basket