Recombinant Mouse Hfe Full Length Transmembrane protein, His-tagged

• Cat.No.: Hfe-4300M
• Product Overview: Recombinant Mouse Hfe protein(P70387)(25-359aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 25-359aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.5 kDa
• AA Sequence: QALPPRSHSLRYLFMGASEPDLGLPLFEARGYVDDQLFVSYNHESRRAEPRAPWILEQTSSQLWLHLSQSLKGWDYMFIVDFWTIMGNYNHSKVTKLGVVSESHILQVVLGCEVHEDNSTSGFWRYGYDGQDHLEFCPKTLNWSAAEPGAWATKVEWDEHKIRAKQNRDYLEKDCPEQLKRLLELGRGVLGQQVPTLVKVTRHWASTGTSLRCQALDFFPQNITMRWLKDNQPLDAKDVNPEKVLPNGDETYQGWLTLAVAPGDETRFTCQVEHPGLDQPLTASWEPLQSQAMIIGIISGVTVCAIFLVGILFLILRKRKASGGTMGGYVLTDCE
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Hfe hemochromatosis [ Mus musculus ]
• Official Symbol: Hfe
• Synonyms: HFE; hemochromatosis; hereditary hemochromatosis protein homolog; MR2; MGC151121; MGC151123
• Gene ID: 15216
• mRNA Refseq: NM_010424
• Protein Refseq: NP_034554