Recombinant Mouse Hfe Full Length Transmembrane protein, His-tagged
Cat.No. : | Hfe-4300M |
Product Overview : | Recombinant Mouse Hfe protein(P70387)(25-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-359aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.5 kDa |
AA Sequence : | QALPPRSHSLRYLFMGASEPDLGLPLFEARGYVDDQLFVSYNHESRRAEPRAPWILEQTSSQLWLHLSQSLKGWDYMFIVDFWTIMGNYNHSKVTKLGVVSESHILQVVLGCEVHEDNSTSGFWRYGYDGQDHLEFCPKTLNWSAAEPGAWATKVEWDEHKIRAKQNRDYLEKDCPEQLKRLLELGRGVLGQQVPTLVKVTRHWASTGTSLRCQALDFFPQNITMRWLKDNQPLDAKDVNPEKVLPNGDETYQGWLTLAVAPGDETRFTCQVEHPGLDQPLTASWEPLQSQAMIIGIISGVTVCAIFLVGILFLILRKRKASGGTMGGYVLTDCE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Hfe hemochromatosis [ Mus musculus ] |
Official Symbol | Hfe |
Synonyms | HFE; hemochromatosis; hereditary hemochromatosis protein homolog; MR2; MGC151121; MGC151123; |
Gene ID | 15216 |
mRNA Refseq | NM_010424 |
Protein Refseq | NP_034554 |
◆ Recombinant Proteins | ||
HFE-4144M | Recombinant Mouse HFE Protein, His (Fc)-Avi-tagged | +Inquiry |
HFE-4467H | Recombinant Human HFE protein, His&Myc-tagged | +Inquiry |
HFE-1231H | Recombinant Human HFE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HFE-1065H | Recombinant Human HFE Protein, His (Fc)-Avi-tagged | +Inquiry |
HFE-4721H | Recombinant Human HFE Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HFE-5572HCL | Recombinant Human HFE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Hfe Products
Required fields are marked with *
My Review for All Hfe Products
Required fields are marked with *
0
Inquiry Basket