Recombinant Human EGR1 protein, His-tagged

Cat.No. : EGR1-52
Product Overview : Recombinant Human EGR1 fused with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 282-433 a.a.
Description : The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppressor gene.
Form : Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4
Molecular Mass : 19.9kD
AA Sequence : MGSSHHHHHHSSGLVPRGSHMQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHE RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDE RKRHTKIHLRQKDKKADKSVVAS
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Notes : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name EGR1 early growth response 1 [ Homo sapiens ]
Official Symbol EGR1
Synonyms EGR1; early growth response 1; early growth response protein 1; AT225; G0S30; KROX 24; nerve growth factor induced protein A; NGFI A; TIS8; transcription factor ETR103; ZIF 268; zinc finger protein 225; ZNF225; EGR-1; transcription factor Zif268; zinc finger protein Krox-24; nerve growth factor-induced protein A; NGFI-A; KROX-24; ZIF-268;
Gene ID 1958
mRNA Refseq NM_001964
Protein Refseq NP_001955
MIM 128990
UniProt ID P18146
Chromosome Location 5q23-q31
Pathway Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity; double-stranded DNA binding; histone acetyltransferase binding; metal ion binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region sequence-specific DNA binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EGR1 Products

Required fields are marked with *

My Review for All EGR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon