Recombinant Full Length Arabidopsis Thaliana Translocase Of Chloroplast 34, Chloroplastic(Toc34) Protein, His-Tagged
Cat.No. : | RFL794AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Translocase of chloroplast 34, chloroplastic(TOC34) Protein (Q38906) (1-313aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-313) |
Form : | Lyophilized powder |
AA Sequence : | MAALQTLREWIGIQQFPPATQSKLLEILGKYKEEDVSSLTVLVMGKGGVGKSSTVNSVIG EKAAAVSTFQSEGLRPTLVSRTRSGFTLNIIDTPGLIEGGYVNDQAINIIKRFLLNMTID VLLYVDRLDVYRVDDLDRQVVGAITDAFGKEIWKKSALVLTHAQFSPPDGLNYNHFVSKR SNALLKVIQTGAQLKKQDLQGFSIPVILVENSGRCHKNESDEKILPCGTSWIPNLFNKIT EISFNGNKAIHVDKKLVEGPNPNERGKKLIPLMFAFQYLLVMKPLVRAIKSDVSRESKPA WELRDSGLASRRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TOC34 |
Synonyms | TOC34; OEP34; PPI3; At5g05000; MUG13.14; Translocase of chloroplast 34, chloroplastic; AtToc34; 34 kDa chloroplast outer envelope protein; GTP-binding protein OEP34; Plastid protein import 3 |
UniProt ID | Q38906 |
◆ Recombinant Proteins | ||
IL7-1559H | Recombinant human IL7, Active, His-tagged | +Inquiry |
SAP060A-006-2611S | Recombinant Staphylococcus aureus (strain: 502A, other: MSSA) SAP060A_006 protein, His-tagged | +Inquiry |
CSF1-418H | Active Recombinant Human CSF1 | +Inquiry |
CALM3-2233H | Recombinant Human CALM3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTSW-2364HF | Recombinant Full Length Human CTSW Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CGB-8048H | Native Human Urine Beta Chorionic Gonadotropin (b-hCG) | +Inquiry |
MLC-240H | Native Human Myosin Light Chain | +Inquiry |
FTL-673H | Native Human Ferritin, Light Polypeptide | +Inquiry |
Lectin-1733L | Active Native Lens Culinaris Agglutinin Protein, Rhodamine labeled | +Inquiry |
THBS1-5524H | Natve Human Thrombospondin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK9-4487HCL | Recombinant Human MAPK9 293 Cell Lysate | +Inquiry |
CORO2A-7341HCL | Recombinant Human CORO2A 293 Cell Lysate | +Inquiry |
ANXA7-8826HCL | Recombinant Human ANXA7 293 Cell Lysate | +Inquiry |
LINC00174-4694HCL | Recombinant Human LOC285908 293 Cell Lysate | +Inquiry |
IFNA10-1702HCL | Recombinant Human IFNA10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TOC34 Products
Required fields are marked with *
My Review for All TOC34 Products
Required fields are marked with *
0
Inquiry Basket