Recombinant Full Length Arabidopsis Thaliana Surfeit Locus Protein 1-Like(At1G48510) Protein, His-Tagged
Cat.No. : | RFL14538AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Surfeit locus protein 1-like(At1g48510) Protein (Q9LP74) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-384) |
Form : | Lyophilized powder |
AA Sequence : | MTKLVSKIFKRLISQSQYMSSSTTSNLPAASQTSNLESQLLSSAPPPAKKKRGSALLWYL VGFTTYGLGETYKFLQTQVEHLDSRKQCLEMKPMKLNTTKDLDGLGFRRVVCKGIFDEQR SIYVGPKPRSMSKSSEIGFYVITPLLPIPNEPNSMKSPILVNRGWVPSDWKENSLESLGT GGLVAAAKESRKANKLLSSQQSLLSKFWYKLNNPMIVEDQVSRAMHVEVVGVVRKSETPG IYTLVNYPSSLAWFYLDVPKLALAMGFGEDTMYIESTYTDMDESRTYPVPRDVENLTRSK DIPLDYHLYTVLWHWSSLTCFIKASSILMRRLTKSDPIGVEPILIPISILVFICTKIYSL RNLFCKIDTIGVGCVTKLDTGKVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At1g48510 |
Synonyms | At1g48510; T1N15.12; Surfeit locus protein 1-like; Surfeit 1-like; Cytochrome c oxidase assembly protein SURF1-like |
UniProt ID | Q9LP74 |
◆ Recombinant Proteins | ||
CAPNS1-2487H | Recombinant Human CAPNS1 Protein, MYC/DDK-tagged | +Inquiry |
DNAJC24-6289H | Recombinant Human DNAJC24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DNASE1-1576R | Recombinant Rat DNASE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL12829SF | Recombinant Full Length Staphylococcus Aureus Signal Transduction Histidine-Protein Kinase Arls(Arls) Protein, His-Tagged | +Inquiry |
GLB1-2329Z | Recombinant Zebrafish GLB1 | +Inquiry |
◆ Native Proteins | ||
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
Avidin-015 | Native Avidin Protein, Peroxidase conjugated | +Inquiry |
TF-71R | Native Rat Apotransferrin | +Inquiry |
Collagen-121B | Native Bovine Type II Collagen, FITC-tagged | +Inquiry |
Fxa-66R | Native Rat Factor Ixa | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTF2F2-5699HCL | Recombinant Human GTF2F2 293 Cell Lysate | +Inquiry |
GABBR2-6072HCL | Recombinant Human GABBR2 293 Cell Lysate | +Inquiry |
RPS3-563HCL | Recombinant Human RPS3 lysate | +Inquiry |
IRF6-5161HCL | Recombinant Human IRF6 293 Cell Lysate | +Inquiry |
ACOT1-9091HCL | Recombinant Human ACOT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All At1g48510 Products
Required fields are marked with *
My Review for All At1g48510 Products
Required fields are marked with *
0
Inquiry Basket