Recombinant Full Length Arabidopsis Thaliana S-Acyltransferase Tip1(Tip1) Protein, His-Tagged
Cat.No. : | RFL12526AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana S-acyltransferase TIP1(TIP1) Protein (Q52T38) (1-620aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-620) |
Form : | Lyophilized powder |
AA Sequence : | MSSEIEVVEEIQSNPKENGESSSKGIEEESLKNDVYTAAAYGDLEKLHRLVECEGSSVSE PDALGYYALQWSALNNRVAVAQYLIEHGGDVNATDHTGQTALHWSAVRGAIQVAELLLQE GARVDATDMYGYQATHVAAQYGQTAFLCHVVSKWNADPDVPDNDGRSPLHWAAYKGFADS IRLLLFLDAYRGRQDKEGCTPLHWAAIRGNLEACTVLVQAGKKEDLMITDKTGLTPAQLA AEKNHRQVSFFLGNARSLLEKRCDGSSPLGRLSKLGLAPVLWIMILLLLLVYTNSVVLAS NLPKLTTGIGALAWLGFILATAGLFLFYRCSRKDPGYIRMNIHDPQTMKDDEPLLKIELN NPALLAGNWTQLCATCKIIRPLRAKHCSTCDRCVEQFDHHCPWVSNCVGKKNKWEFFLFL LLEVLAMLITGGVTLARVLSDPSAPSSFGAWMSHVASNHVGALSFLLVEFCLFFSVAVLT VIQASQISRNITTNEMANALRYSYLRGPGGRFRNPYDLGCRRNCSDFLVKGYNEDIECHE EDATQRPEGISMMQMQRNPNLQNGNGHVAIDVNPTHNSQSAHVHSANCSHSHNSKSKSDN VPLGLGLGLSRNPTRPVVSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PAT24 |
Synonyms | PAT24; TIP1; At5g20350; F5O24.240; Protein S-acyltransferase 24; Ankyrin repeat-containing S-palmitoyltransferase; Palmitoyltransferase TIP1; Protein TIP GROWTH DEFECTIVE 1; AtTIP1; Zinc finger DHHC domain-containing protein TIP1 |
UniProt ID | Q52T38 |
◆ Recombinant Proteins | ||
CD97-3134H | Active Recombinant Human CD97, Fc tagged | +Inquiry |
KCNJ2-8517M | Recombinant Mouse KCNJ2 Protein | +Inquiry |
CLTCA-1404Z | Recombinant Zebrafish CLTCA | +Inquiry |
PLCG2-4930H | Recombinant Human PLCG2 Protein (Leu930-Thr1152), N-His tagged | +Inquiry |
RFL4167DF | Recombinant Full Length Dehalococcoides Ethenogenes Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgG-019R | Native Rat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Lectin-1850U | Active Native Ulex Europaeus Agglutinin I Protein, Biotinylated | +Inquiry |
Proteoglycans-53H | Native Human Proteoglycans | +Inquiry |
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
PGA-130H | Active Native Human Pepsinogen I | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX21-1593HCL | Recombinant Human SNX21 293 Cell Lysate | +Inquiry |
GRM8-5731HCL | Recombinant Human GRM8 293 Cell Lysate | +Inquiry |
LOC391763-1015HCL | Recombinant Human LOC391763 cell lysate | +Inquiry |
PDZRN3-1329HCL | Recombinant Human PDZRN3 cell lysate | +Inquiry |
Spinal Cord-60H | Human Spinal Cord Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAT24 Products
Required fields are marked with *
My Review for All PAT24 Products
Required fields are marked with *
0
Inquiry Basket