Recombinant Full Length Arabidopsis Thaliana Ring-H2 Finger Protein Atl63(Atl63) Protein, His-Tagged
Cat.No. : | RFL18656AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana RING-H2 finger protein ATL63(ATL63) Protein (Q9LUZ9) (1-308aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-308) |
Form : | Lyophilized powder |
AA Sequence : | MSEEDGGSMSVKSSLSSFLKILSSYNSNVLLAALVFLLLVVLFVLLLHFYARFFWSPSHQ DFSAAARHRRRRRRNRRRTVTTTRIIPSLPLGGFDDGVSSPAATATRDDKGLDSSVISSI PLFVYEENEEEEDEEEECVICLGLWEAGDFGRKLRNCGHGFHVECIDMWLSSHSTCPLCR SPVLAAVSDEENLKLAVNAVEEEAEVRLQMSPAGENESNVSGDRRVSLSLSVMEDDLKTG DDDGEEEVRIEVFDDDEEINDGGTRSDRRRSMSMTSSASSSLMRMLSSSSSRSERNKVFP TARQDSSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATL63 |
Synonyms | ATL63; At5g58580; MZN1.3; RING-H2 finger protein ATL63; Protein ARABIDOPSIS TOXICOS EN LEVADURA 63; Protein ATL63; RING-type E3 ubiquitin transferase ATL63 |
UniProt ID | Q9LUZ9 |
◆ Recombinant Proteins | ||
ATP2A1-2944H | Recombinant Human ATP2A1 Protein, MYC/DDK-tagged | +Inquiry |
MTLR-0366B | Recombinant Bacillus subtilis MTLR protein, His-tagged | +Inquiry |
RFL32993BF | Recombinant Full Length Bovine Endothelin-Converting Enzyme 1(Ece1) Protein, His-Tagged | +Inquiry |
GRID1-5334H | Recombinant Human GRID1 Protein, GST-tagged | +Inquiry |
CPE-2952H | Recombinant Human CPE protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
C5a-12H | Active Native Human C5a Anaphylatoxin Protein | +Inquiry |
SERPINA3-5331H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 3 | +Inquiry |
APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
ALB-584P | Native Guinea Pig ALB protein | +Inquiry |
LDH-217R | Active Native Rabbit Lactate Dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECM1-2036MCL | Recombinant Mouse ECM1 cell lysate | +Inquiry |
ZNF70-23HCL | Recombinant Human ZNF70 293 Cell Lysate | +Inquiry |
ZNF444-2028HCL | Recombinant Human ZNF444 cell lysate | +Inquiry |
PDGFD-3336HCL | Recombinant Human PDGFD 293 Cell Lysate | +Inquiry |
DCP2-446HCL | Recombinant Human DCP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATL63 Products
Required fields are marked with *
My Review for All ATL63 Products
Required fields are marked with *
0
Inquiry Basket