Recombinant Human GRID1 Protein, GST-tagged

• Cat.No.: GRID1-5334H
• Product Overview: Human GRID1 partial ORF ( NP_060021, 349 a.a. - 441 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a subunit of glutamate receptor channels. These channels mediate most of the fast excitatory synaptic transmission in the central nervous system and play key roles in synaptic plasticity
• Molecular Mass: 35.97 kDa
• AA Sequence: LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GRID1 glutamate receptor, ionotropic, delta 1 [ Homo sapiens ]
• Official Symbol: GRID1
• Synonyms: GRID1; glutamate receptor, ionotropic, delta 1; glutamate receptor delta-1 subunit; GluD1; KIAA1220; gluR delta-1 subunit
• Gene ID: 2894
• mRNA Refseq: NM_017551
• Protein Refseq: NP_060021
• MIM: 610659
• UniProt ID: Q9ULK0