Recombinant Human GRID1 Protein, GST-tagged
Cat.No. : | GRID1-5334H |
Product Overview : | Human GRID1 partial ORF ( NP_060021, 349 a.a. - 441 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a subunit of glutamate receptor channels. These channels mediate most of the fast excitatory synaptic transmission in the central nervous system and play key roles in synaptic plasticity |
Molecular Mass : | 35.97 kDa |
AA Sequence : | LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRID1 glutamate receptor, ionotropic, delta 1 [ Homo sapiens ] |
Official Symbol | GRID1 |
Synonyms | GRID1; glutamate receptor, ionotropic, delta 1; glutamate receptor delta-1 subunit; GluD1; KIAA1220; gluR delta-1 subunit; |
Gene ID | 2894 |
mRNA Refseq | NM_017551 |
Protein Refseq | NP_060021 |
MIM | 610659 |
UniProt ID | Q9ULK0 |
◆ Recombinant Proteins | ||
GRID1-28535TH | Recombinant Human GRID1 | +Inquiry |
GRID1-1796R | Recombinant Rhesus Macaque GRID1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRID1-3958H | Recombinant Human GRID1 protein, His-tagged | +Inquiry |
GRID1-7260M | Recombinant Mouse GRID1 Protein | +Inquiry |
GRID1-5334H | Recombinant Human GRID1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRID1-310HCL | Recombinant Human GRID1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRID1 Products
Required fields are marked with *
My Review for All GRID1 Products
Required fields are marked with *
0
Inquiry Basket