Recombinant Full Length Arabidopsis Thaliana Ring-H2 Finger Protein Atl2(Atl2) Protein, His-Tagged
Cat.No. : | RFL36584AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana RING-H2 finger protein ATL2(ATL2) Protein (Q8L9T5) (1-304aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-304) |
Form : | Lyophilized powder |
AA Sequence : | MNSNDQDPIPFRPEDNNFSGSKTYAMSGKIMLSAIVILFFVVILMVFLHLYARWYLLRAR RRHLRRRSRNRRATMVFFTADPSTAATSVVASRGLDPNVIKSLPVFTFSDETHKDPIECA VCLSEFEESETGRVLPNCQHTFHVDCIDMWFHSHSTCPLCRSLVESLAGIESTAAARERE VVIAVDSDPVLVIEPSSSSGLTDEPHGSGSSQMLREDSGRKPAAIEVPRRTFSEFEDELT RRDSPASQSFRSPMSRMLSFTRMLSRDRRSASSPIAGAPPLSPTLSCRIQMTESDIERGG EESR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATL2 |
Synonyms | ATL2; At3g16720; MGL6.19; RING-H2 finger protein ATL2; Protein ARABIDOPSIS TOXICOS EN LEVADURA 2; Protein ATL2; RING-type E3 ubiquitin transferase ATL2 |
UniProt ID | Q8L9T5 |
◆ Recombinant Proteins | ||
ARL6IP2-818H | Recombinant Human ARL6IP2 protein, GST-tagged | +Inquiry |
ATL2-6089Z | Recombinant Zebrafish ATL2 | +Inquiry |
ATL2-70C | Recombinant Cynomolgus Monkey ATL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL36584AF | Recombinant Full Length Arabidopsis Thaliana Ring-H2 Finger Protein Atl2(Atl2) Protein, His-Tagged | +Inquiry |
RFL4607MF | Recombinant Full Length Mouse Atlastin-2(Atl2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATL2-122HCL | Recombinant Human ATL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATL2 Products
Required fields are marked with *
My Review for All ATL2 Products
Required fields are marked with *
0
Inquiry Basket