Recombinant Human ARL6IP2 protein, GST-tagged

• Cat.No.: ARL6IP2-818H
• Product Overview: Human ARL6IP2 full-length ORF ( AAH53508, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ATL2 (Atlastin GTPase 2) is a Protein Coding gene. Diseases associated with ATL2 include Spastic Paraplegia 3A. GO annotations related to this gene include identical protein binding and GTPase activity. An important paralog of this gene is ATL1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 71.06 kDa
• AA Sequence: MDTQGAFDSQSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLMFLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPGLKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVAGARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFAVMFAMYIISGLTGFIGLNSIAVLCNLVMGLALIFLCTWAYVKYSGEFREIGTVIDQIAETLWEQVLKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATL2 atlastin GTPase 2 [ Homo sapiens (human) ]
• Official Symbol: ATL2
• Synonyms: ATL2; atlastin GTPase 2; aip-2; ARL3IP2; ARL6IP2; atlastin2; atlastin-2; ADP-ribosylation factor-like protein 6-interacting protein 2; ARL-6-interacting protein 2; EC 3.6.5.-
• Gene ID: 64225
• mRNA Refseq: NM_001135673
• Protein Refseq: NP_001129145
• MIM: 609368
• UniProt ID: Q8NHH9