Recombinant Full Length Arabidopsis Thaliana Putative Ring-H2 Finger Protein Atl50(Atl50) Protein, His-Tagged
Cat.No. : | RFL27052AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Putative RING-H2 finger protein ATL50(ATL50) Protein (Q9FHG8) (1-210aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-210) |
Form : | Lyophilized powder |
AA Sequence : | MDQKSDSFLSVSSISFSYSSSTDKDFDLICMISPIVLLYITLLSIIFFVAALIHLLVKFL HRPQTRLDDAYDGITESSTALQGRYQTRFNLHDAEIDQSFIDALPLLHYKTMIGLRHDLS DCAVCLREFTAEDELRLLPKCSHAFHVECIDTWLLTNSTCPLCRDNLLLLGLTGTASSST IVLVHESDGDNSQDSDSSFMLTDLDDVESK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATL50 |
Synonyms | ATL50; At5g57750; MRI1.11; Putative RING-H2 finger protein ATL50; RING-type E3 ubiquitin transferase ATL50 |
UniProt ID | Q9FHG8 |
◆ Recombinant Proteins | ||
LLGL1-3422R | Recombinant Rat LLGL1 Protein | +Inquiry |
RFL29153OF | Recombinant Full Length Ostreid Herpesvirus 1 Putative Transmembrane Protein Orf103(Orf103) Protein, His-Tagged | +Inquiry |
Efna5-4060M | Active Recombinant Mouse Efna5 protein, His-tagged | +Inquiry |
PARP11-3319H | Recombinant Human PARP11 protein, His-tagged | +Inquiry |
EPHA8-6999H | Recombinant Human EPHA8, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CASQ2-30C | Native Canine CASQ2 | +Inquiry |
VLDL-252H | Native Human Very Low Density Lipoprotein | +Inquiry |
Compound E-12 | Compound E, Antibotics Free | +Inquiry |
CAT-1187B | Native Bovine Catalase | +Inquiry |
C1Q-20H | Active Native Human C1q Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYTL2-1300HCL | Recombinant Human SYTL2 293 Cell Lysate | +Inquiry |
DYNLT1-6754HCL | Recombinant Human DYNLT1 293 Cell Lysate | +Inquiry |
CXCL16-2545MCL | Recombinant Mouse CXCL16 cell lysate | +Inquiry |
DDX27-7012HCL | Recombinant Human DDX27 293 Cell Lysate | +Inquiry |
NAB2-3988HCL | Recombinant Human NAB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATL50 Products
Required fields are marked with *
My Review for All ATL50 Products
Required fields are marked with *
0
Inquiry Basket