Recombinant Human PARP11 protein, His-tagged

• Cat.No.: PARP11-3319H
• Product Overview: Recombinant Human PARP11 protein(Q9NR21)(2-331aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 41 kDa
• Protein length: 2-331aa
• AA Sequence: FHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PARP11 poly (ADP-ribose) polymerase family, member 11 [ Homo sapiens ]
• Official Symbol: PARP11
• Synonyms: PARP11; poly (ADP-ribose) polymerase family, member 11; C12orf6, chromosome 12 open reading frame 6; poly [ADP-ribose] polymerase 11; MIB006; PARP-11; C12orf6; DKFZp779H0122
• Gene ID: 57097
• mRNA Refseq: NM_020367
• Protein Refseq: NP_065100
• UniProt ID: Q9NR21