Recombinant Full Length Arabidopsis Thaliana Putative Ring-H2 Finger Protein Atl12(Atl12) Protein, His-Tagged
Cat.No. : | RFL36787AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Putative RING-H2 finger protein ATL12(ATL12) Protein (Q9SL78) (23-390aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-390) |
Form : | Lyophilized powder |
AA Sequence : | QSPPPPNLYATSDLFKPSLAIITGVFSIVFTLTFVLLVYAKCFHNDLRSETDSDGERIRH DRLWQGLFNRSSRFSGLDKKAIESLPFFRFSALKGLKQGLECSVCLSKFEDVEILRLLPK CRHAFHIGCIDQWLEQHATCPLCRNRVNIEDDLSVLGNSSTSLRILNQSETREEDSRLEI YIEREEGTNDGSSRFSSFRKILKKSLLLEREGNENIDEKKLMHKFNHRIVVSDAVFKNRW SNITSSDLTFLTSEMLNSVSSDRFSSVDRVHRGNLRDKEDMEMKRMLIKHKDSSRRTVSE ITTVSREKAVGGSYRGSTASTSQNYAVTATTEERRRRLWLPIARRTAQWFVNREKSNDLN TTRQNLNV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATL12 |
Synonyms | ATL12; At2g20030; T2G17.17; Putative RING-H2 finger protein ATL12; RING-type E3 ubiquitin transferase ATL12 |
UniProt ID | Q9SL78 |
◆ Recombinant Proteins | ||
MEMO1-3301R | Recombinant Rat MEMO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBBP9-2202H | Recombinant Human RBBP9, GST-tagged | +Inquiry |
MT4-704H | Recombinant Human MT4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MOEB-1463B | Recombinant Bacillus subtilis MOEB protein, His-tagged | +Inquiry |
SPON2-2928H | Recombinant Human SPON2, His-tagged | +Inquiry |
◆ Native Proteins | ||
TIMP1-30840TH | Native Human TIMP1 | +Inquiry |
Protein Z-91H | Native Human Protein Z | +Inquiry |
Tyrosinase-39 | Native Tyrosinase, Enzyme Activity | +Inquiry |
Collagen Type III-07H | Native Human Collagen Type III | +Inquiry |
Lectin-1860W | Active Native Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC85B-161HCL | Recombinant Human CCDC85B lysate | +Inquiry |
TREM1-2140HCL | Recombinant Human TREM1 cell lysate | +Inquiry |
YWHAQ-230HCL | Recombinant Human YWHAQ 293 Cell Lysate | +Inquiry |
AIFM3-8952HCL | Recombinant Human AIFM3 293 Cell Lysate | +Inquiry |
RRP1-2143HCL | Recombinant Human RRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATL12 Products
Required fields are marked with *
My Review for All ATL12 Products
Required fields are marked with *
0
Inquiry Basket