Recombinant Full Length Arabidopsis Thaliana Putative Cyclic Nucleotide-Gated Ion Channel 7(Cngc7) Protein, His-Tagged
Cat.No. : | RFL25843AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Putative cyclic nucleotide-gated ion channel 7(CNGC7) Protein (Q9S9N5) (1-738aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-738) |
Form : | Lyophilized powder |
AA Sequence : | MYKSQYISGQREKFVRLDDIDSSSSPATGMMMQRNCFGFNLKNRGGEKKKASKSFREGVK KIRSEGLITIGKSVTRAVFPEDLRITEKKIFDPQDKTLLVWNRLFVISCILAVSVDPLFF YLPIVDNSGSSCIGIDTKLAVTTTTLRTIVDVFYLTRMALQFRTAYIAPSSRVFGRGELV IDPAKIAERYLTRYFVVDFLAVLPLPQIAVWKFLHGSKGSDVLPTKTALLNIVIVQYIPR FVRFIPLTSELKKTAGAFAEGAWAGAAYYLLWYMLASHITGAFWYMLSVERNDTCWRFAC KVQPDPRLCVQILYCGTKFVSSGETEWIKTVPELLKSNCSAKADDSKFNYGIYGQAISSG IVSSTTFFSKFCYCLWWGLQNLSTLGQGLQTSTFPGEVLFSIAIAIAGLLLFALLIGNMQ TYLQSLTVRLEEMRIKRRDSEQWMHHRSLPQNLRERVRRYDQYKWLETRGVDEENIVQSL PKDLRRDIKRHLCLNLVRRVPLFANMDERLLDAICERLKPSLFTESTYIVREGDPVNEMM FIIRGRLESVTTDGGRSGFFNRGLLKEGDFCGEELLTWALDPKAGSNLPSSTRTVKALTE VEAFALEAEELKFVASQFRRLHSRQVQQTFRFYSQQWRTWASCFIQAAWRRYSRRKNAEL RRIEEKEEELGYEDEYDDESDKRPMVITRSESSSRLRSTIFASRFAANALKGHRLRSSES SKTLINLQKPPEPDFDAE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CNGC7 |
Synonyms | CNGC7; At1g15990; T24D18.9; Putative cyclic nucleotide-gated ion channel 7; Cyclic nucleotide- and calmodulin-regulated ion channel 7 |
UniProt ID | Q9S9N5 |
◆ Recombinant Proteins | ||
TMS1-4015H | Recombinant Human TMS1 protein, His-tagged | +Inquiry |
PPP2R2D-1645C | Recombinant Chicken PPP2R2D | +Inquiry |
Tnfrsf21-1066M | Recombinant Mouse Tnfrsf21 protein, His-tagged | +Inquiry |
PLK428748H | Recombinant Human PLK4 (1-271) (T170D) Protein | +Inquiry |
PHB2A-10079Z | Recombinant Zebrafish PHB2A | +Inquiry |
◆ Native Proteins | ||
20S Immunoproteasome-225C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
HP-4387H | Native Human Haptoglobin | +Inquiry |
Lectin-1785G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Fluorescein labeled | +Inquiry |
pla-001H | Human Protein S Deficient Plasma | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST3GAL4-633HCL | Recombinant Human ST3GAL4 lysate | +Inquiry |
GREM2-5752HCL | Recombinant Human GREM2 293 Cell Lysate | +Inquiry |
PEX12-3293HCL | Recombinant Human PEX12 293 Cell Lysate | +Inquiry |
GTDC1-5706HCL | Recombinant Human GTDC1 293 Cell Lysate | +Inquiry |
RBMS1-2463HCL | Recombinant Human RBMS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CNGC7 Products
Required fields are marked with *
My Review for All CNGC7 Products
Required fields are marked with *
0
Inquiry Basket