Recombinant Full Length Arabidopsis Thaliana Putative Cyclic Nucleotide-Gated Ion Channel 13(Cngc13) Protein, His-Tagged
Cat.No. : | RFL36883AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Putative cyclic nucleotide-gated ion channel 13(CNGC13) Protein (Q9LD40) (1-696aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-696) |
Form : | Lyophilized powder |
AA Sequence : | MAFGRNNRVRFRDWISEGTEYGYGRNKARPSLNTVLKNVRRGLKKPLSFGSHNKKRDSNS STTTQKNIINPQGSFLQNWNKIFLFASVIALAIDPLFFYIPIVDGERHCLNLHRNLEIAA SVLRTFIDAFYIIHIVFQFRTAYISPSSRVFGRGELVDDPKAIAIKYLSSYFIIDLLSIL PLPQLVVLAVIPNVNKPVSLITKDYLITVIFTQYIPRILRIYPLYTEVTRTSGIVTETAW AGAAWNLSLYMLASHVFGALWYLISVEREDRCWREACEKIPEVCNFRFLYCDGNSSVRND FLTTSCPFINPDDITNSTVFNFGIFTDALKSGIVESDDFWKKFFYCFWWGLRNLSALGQN LNTSKFVGEIIFAVSICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRM LPDDLRKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDE QLLDAVCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKPS DFCGEDLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFRRLHSKQLQH TFRFYSVQWRTWGASFIQAAWRRHCRRKLARSLTEEEDRFRNAITKRERNAASSSSLVAT LYASRFASNALRNLRTNNLPLLPPKPSEPDFSLRNP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CNGC13 |
Synonyms | CNGC13; At4g01010; F3I3.1; Putative cyclic nucleotide-gated ion channel 13; Cyclic nucleotide- and calmodulin-regulated ion channel 13 |
UniProt ID | Q9LD40 |
◆ Recombinant Proteins | ||
Helt-3381M | Recombinant Mouse Helt Protein, Myc/DDK-tagged | +Inquiry |
Cdh2-7026R | Recombinant Rat Cdh2 protein, His-tagged | +Inquiry |
FAM163A-3717H | Recombinant Human FAM163A Protein, GST-tagged | +Inquiry |
FAM102B-4452HF | Recombinant Full Length Human FAM102B Protein, GST-tagged | +Inquiry |
MIPOL1-5350H | Recombinant Human MIPOL1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
L. biflexa-27 | Native Leptospira biflexa Antigen | +Inquiry |
Ferritin-024B | Native Bovine Ferritin Protein, holo form | +Inquiry |
ITGA2B-10H | Native Human GPIIbIIIa | +Inquiry |
RO60-18C | Native Cattle RO60 Protein | +Inquiry |
Adv2-10 | Native Adenovirus Type 2 Hexon Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Parietal Lobe-376C | Cynomolgus monkey Parietal Lobe Lysate | +Inquiry |
GSR-757HCL | Recombinant Human GSR cell lysate | +Inquiry |
HNRNPH1-5446HCL | Recombinant Human HNRNPH1 293 Cell Lysate | +Inquiry |
OXA1L-1265HCL | Recombinant Human OXA1L cell lysate | +Inquiry |
IgG2a-1608MCL | Recombinant Mouse IgG2a cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNGC13 Products
Required fields are marked with *
My Review for All CNGC13 Products
Required fields are marked with *
0
Inquiry Basket