Recombinant Full Length Human FAM102B Protein, GST-tagged

• Cat.No.: FAM102B-4452HF
• Product Overview: Human FAM102B full-length ORF ( NP_001010883.1, 1 a.a. - 329 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 329 amino acids
• Description: FAM102B (Family With Sequence Similarity 102 Member B) is a Protein Coding gene. An important paralog of this gene is FAM102A.
• Molecular Mass: 62 kDa
• AA Sequence: MRLLDGGSFTAESSREVVQANCVRWRKKFSFMCKMSASAATGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTTRRCLLEGYDTKNTRQDNSILKVLISMQLMSGDPCFKTPPSTSMSIPIAGESESLQEDRKGGETLKVHLGIADLSAKSASVPDELGACGHSRTSSYASQQSKVSGYSTCHSRSSSFSELCHRRNTSVGSTSTGVESILEPCDEIEQKIAEPNLDTADKEDTASEKLSRCPVKQDSVESQLKRVDDTRVDADDIVEKILQSQDFSLDSSAEEEGLRLFVGPGGSTTFGSHHLPNRVGSGAYEQVVIKR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM102B family with sequence similarity 102, member B [ Homo sapiens ]
• Official Symbol: FAM102B
• Synonyms: FAM102B; family with sequence similarity 102, member B; protein FAM102B; DKFZp779B126; DKFZp686N01110
• Gene ID: 284611
• mRNA Refseq: NM_001010883
• Protein Refseq: NP_001010883
• UniProt ID: Q5T8I3