Recombinant Full Length Arabidopsis Thaliana Protein Disulfide-Isomerase 5-2(Pdil5-2) Protein, His-Tagged
Cat.No. : | RFL17588AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Protein disulfide-isomerase 5-2(PDIL5-2) Protein (Q94F09) (24-440aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (24-440) |
Form : | Lyophilized powder |
AA Sequence : | SDDQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPELDAAAPILAKLKQ PIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFVAPDVA VLESDSTVKEFVEDAGTFFPVFIGFGLNESIISGLGRKYKKKAWFAVSKEVSEDTMVSYD FDKAPALVANHPTYNEHSVFYGPFEDGFLEEFVKQSFLPLILPINHDTLKLLKDDERKIV LTIVEDETHESLEKLYKALRAAAHANRDLVFGYVGVKQFEEFVDSFHVDKKTNLPKIVVW DGDEEYDQVTGIETITQEEDHLTQVSRFLEGYREGRTEKKKINGPSFMGFINSMIGIRSV YILVFLVAVIMMLRSLGQVEEPTGVRTATAVRERVDQATTVPEDESSEHKPSDKKED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PDIL5-2 |
Synonyms | PDIL5-2; PDI8; PDIL7-1; At1g35620; F15O4.20; Protein disulfide-isomerase 5-2; AtPDIL5-2; Protein disulfide-isomerase 7-1; AtPDIL7-1; Protein disulfide-isomerase 8; PDI8 |
UniProt ID | Q94F09 |
◆ Recombinant Proteins | ||
SP110-31432TH | Recombinant Human SP110 | +Inquiry |
RFL-31840XF | Recombinant Full Length Xenopus Tropicalis Apoptosis-Inducing Factor 2(Aifm2) Protein, His-Tagged | +Inquiry |
RFL13373RF | Recombinant Full Length Rat Tumor Necrosis Factor Receptor Superfamily Member 4(Tnfrsf4) Protein, His-Tagged | +Inquiry |
GATA2-1252HFL | Recombinant Full Length Human GATA2 Protein, C-Flag-tagged | +Inquiry |
NLRP4B-6098M | Recombinant Mouse NLRP4B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1840S | Active Native Sambucus Nigra Lectin Protein, Cy5 labeled | +Inquiry |
APOB-8037H | Native Human Plasma APOB | +Inquiry |
AsAGP-002B | Native Bovine Asialo-a1-acid glycoprotein Protein | +Inquiry |
TF-261M | Native Monkey Transferrin | +Inquiry |
CDA016 | Native Hepatitis B Surface Ag protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC14L1-1999HCL | Recombinant Human SEC14L1 293 Cell Lysate | +Inquiry |
NLRP4-3798HCL | Recombinant Human NLRP4 293 Cell Lysate | +Inquiry |
MDP1-4402HCL | Recombinant Human MDP1 293 Cell Lysate | +Inquiry |
CCDC24-7771HCL | Recombinant Human CCDC24 293 Cell Lysate | +Inquiry |
SCGB1A1-1794MCL | Recombinant Mouse SCGB1A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDIL5-2 Products
Required fields are marked with *
My Review for All PDIL5-2 Products
Required fields are marked with *
0
Inquiry Basket