Recombinant Human SP110

Cat.No. : SP110-31432TH
Product Overview : Recombinant fragment corresponding to amino acids 271-380 of Human SP110 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. This gene is a member of the SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. Alternative splicing has been observed for this gene and three transcript variants, encoding distinct isoforms, have been identified.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Highly expressed in peripheral blood leukocytes and spleen. Detected at intermediate levels in thymus, prostate, testis, ovary, small intestine and colon, and at low levels in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQK KLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEE IIDGTSEMNEGKRSQKTPSTPRRVTQGAAS
Sequence Similarities : Contains 1 bromo domain.Contains 1 HSR domain.Contains 1 PHD-type zinc finger.Contains 1 SAND domain.
Gene Name SP110 SP110 nuclear body protein [ Homo sapiens ]
Official Symbol SP110
Synonyms SP110; SP110 nuclear body protein; IFI41, IFI75, interferon induced protein 41, 30kD; sp110 nuclear body protein;
Gene ID 3431
mRNA Refseq NM_001185015
Protein Refseq NP_001171944
MIM 604457
Uniprot ID Q9HB58
Chromosome Location 2q37.1
Function DNA binding; binding; metal ion binding; signal transducer activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SP110 Products

Required fields are marked with *

My Review for All SP110 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon