Recombinant Full Length Arabidopsis Thaliana Probable S-Acyltransferase At3G56930(At3G56930) Protein, His-Tagged
Cat.No. : | RFL30399AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable S-acyltransferase At3g56930(At3g56930) Protein (Q9M1K5) (1-477aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-477) |
Form : | Lyophilized powder |
AA Sequence : | MAWNETKLKRLYQVWRGSNKFLCGGRLIFGPDASSLYLSTILILGPAVMFFVKMYTKMAD PRTKNPNLCIPILCVSWILTILDIFFLLMTSSRDPGIVPRSFRPPETDDAPDSTTPSMEW VSGRTPNIRIPRVKDVTVNGHTVKVKFCDTCLLYRPPRASHCSICNNCVQRFDHHCPWVG QCIGVRNYRFFFMFISTSTTLCIYVFAFSWLNIFQRHMDEKISIWKAISKDVLSDILIVY CFITVWFVGGLTIFHSYLICTNQTTYENFRYRYDKKENPYNKGILGNIWEIFLSKIPPSM NKFRSFVKEEDYMMMMVETPTSNLGESLVSSKEKIDIEMGGGRIVDESGKSYSLPEILRN LNYEDLEDDCEEDDLKAKDHHHHHHHQHQHNEGIIPPFDPFFTNEIGSNKDERNGEESGG SSSDGENTGKRVRVSDEDEEKVEGYERNWSTDKGMNINAGSEDGASSPVSTSPMLRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PAT04 |
Synonyms | PAT04; At3g56930; F24I3.10; Probable protein S-acyltransferase 4; Probable palmitoyltransferase At3g56930; Zinc finger DHHC domain-containing protein At3g56930 |
UniProt ID | Q9M1K5 |
◆ Recombinant Proteins | ||
RDBP-29224TH | Recombinant Human RDBP, His-tagged | +Inquiry |
PTGIR-7258M | Recombinant Mouse PTGIR Protein, His (Fc)-Avi-tagged | +Inquiry |
CAPG-0353H | Recombinant Human CAPG Protein, GST-Tagged | +Inquiry |
RFL1255PF | Recombinant Full Length Simian Virus 5 Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged | +Inquiry |
ULBP1-097H | Recombinant Human ULBP1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
Collagen Type I & III-08R | Native Rat Collagen Type I and III Protein | +Inquiry |
C2-98H | Active Native Human C2 Protein | +Inquiry |
S100B-1116H | Native Human S100B Protein | +Inquiry |
ADVag-281V | Active Native ADV Protein | +Inquiry |
FABP-177R | Native Rabbit Fatty acid Binding Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLCO1B3-1688HCL | Recombinant Human SLCO1B3 293 Cell Lysate | +Inquiry |
TLK2-001HCL | Recombinant Human TLK2 cell lysate | +Inquiry |
SLC13A3-1615HCL | Recombinant Human SLC13A3 cell lysate | +Inquiry |
Fetal Liver-148H | Human Fetal Liver Membrane Lysate | +Inquiry |
C1orf189-8169HCL | Recombinant Human C1orf189 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAT04 Products
Required fields are marked with *
My Review for All PAT04 Products
Required fields are marked with *
0
Inquiry Basket