Recombinant Full Length Arabidopsis Thaliana Probable Beta-1,3-Galactosyltransferase 19(B3Galt19) Protein, His-Tagged
Cat.No. : | RFL17772AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 19(B3GALT19) Protein (Q9LV16) (1-681aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-681) |
Form : | Lyophilized powder |
AA Sequence : | MRKPKLSKLERLEKFDIFVSLSKQRSVQILMAVGLLYMLLITFEIPFVFKTGLSSLSQDP LTRPEKHNSQRELQERRAPTRPLKSLLYQESQSESPAQGLRRRTRILSSLRFDPETFNPS SKDGSVELHKSAKVAWEVGRKIWEELESGKTLKALEKEKKKKIEEHGTNSCSLSVSLTGS DLLKRGNIMELPCGLTLGSHITVVGKPRAAHSEKDPKISMLKEGDEAVKVSQFKLELQGL KAVEGEEPPRILHLNPRLKGDWSGKPVIEQNTCYRMQWGSAQRCEGWRSRDDEETVDGQV KCEKWARDDSITSKEEESSKAASWWLSRLIGRSKKVTVEWPFPFTVDKLFVLTLSAGLEG YHVSVDGKHVTSFPYRTGFTLEDATGLTINGDIDVHSVFAGSLPTSHPSFSPQRHLELSS NWQAPSLPDEQVDMFIGILSAGNHFAERMAVRRSWMQHKLVKSSKVVARFFVALHSRKEV NVELKKEAEFFGDIVIVPYMDSYDLVVLKTVAICEYGAHQLAAKFIMKCDDDTFVQVDAV LSEAKKTPTDRSLYIGNINYYHKPLRQGKWSVTYEEWPEEDYPPYANGPGYILSNDISRF IVKEFEKHKLRMFKMEDVSVGMWVEQFNNGTKPVDYIHSLRFCQFGCIENYLTAHYQSPR QMICLWDKLVLTGKPQCCNMR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GALT6 |
Synonyms | GALT6; B3GALT19; At5g62620; MRG21.3; Hydroxyproline O-galactosyltransferase GALT6; Beta-1,3-galactosyltransferase 19 |
UniProt ID | Q9LV16 |
◆ Recombinant Proteins | ||
SAP037A-012-2253S | Recombinant Staphylococcus aureus (strain: W17S, other: ST93-MSSA) SAP037A_012 protein, His-tagged | +Inquiry |
RFL9864HF | Recombinant Full Length Cdp-Diacylglycerol--Inositol 3-Phosphatidyltransferase(Pgsa1) Protein, His-Tagged | +Inquiry |
HSD17B10-1604Z | Recombinant Zebrafish HSD17B10 | +Inquiry |
ABCB6-398R | Recombinant Rat ABCB6 Protein | +Inquiry |
Relb-1853M | Recombinant Mouse Relb protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
Fxa-283B | Active Native Bovine Factor Xa - DEGR | +Inquiry |
Clostripain-02C | Native Clostridium histolyticum Clostripain, Sequencing Grade | +Inquiry |
RPE-425 | Native Red algae RPE | +Inquiry |
Immunoglobulin D-79H | Native Human Immunoglobulin D | +Inquiry |
◆ Cell & Tissue Lysates | ||
C11orf74-8335HCL | Recombinant Human C11orf74 293 Cell Lysate | +Inquiry |
VMO1-402HCL | Recombinant Human VMO1 293 Cell Lysate | +Inquiry |
AP4B1-8806HCL | Recombinant Human AP4B1 293 Cell Lysate | +Inquiry |
SF268-011WCY | Human Glioblastoma SF268 Whole Cell Lysate | +Inquiry |
WDR92-327HCL | Recombinant Human WDR92 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GALT6 Products
Required fields are marked with *
My Review for All GALT6 Products
Required fields are marked with *
0
Inquiry Basket