Recombinant Full Length Arabidopsis Thaliana Probable Beta-1,3-Galactosyltransferase 13(B3Galt13) Protein, His-Tagged
Cat.No. : | RFL12561AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Probable beta-1,3-galactosyltransferase 13(B3GALT13) Protein (Q9LKA9) (1-343aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-343) |
Form : | Lyophilized powder |
AA Sequence : | MSSSPKLFHARPSFFTRRSTPLIVFTSLAIGLTGFLFGLSTILFPGLRLSGRSCLTNLPP KTVKIVWDVAGNSIVNGEVKRHKVMGFVGIQTGFRSAGRRRALRNTWMPSDPEGLRRLEE STGLAIRFIIGKTKDEAKMVELRSEVAMYDDFILLDIEEEYSKLPYKTLAFFKAAYALYD SEFYVKADDDIYLRPDRLSLLLAKERGHSQTYLGCMKKGPVFTDPKLKWYEPLADLLGKE YFLHAYGPIYALSADVVTSLVALKNNSFRMFSNEDVTIGAWMLAMNVNHENLHTLCEPEC SPYSIAVWDIPKCSGLCNPEKRMLELHMLESCSKSPTLPSDDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | B3GALT13 |
Synonyms | B3GALT13; At3g14960; K15M2.10; Probable beta-1,3-galactosyltransferase 13 |
UniProt ID | Q9LKA9 |
◆ Native Proteins | ||
FGG -48S | Native Sheep Fibrinogen, FITC Labeled | +Inquiry |
Proteasome 26S-38H | Native Human Proteasome 26S Protein, Tag Free | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
ARPC2-01P | Native Porcine ARPC2 Protein (Arp2/3 Protein Complex) | +Inquiry |
IgA-249P | Native Pig Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
LSM7-9170HCL | Recombinant Human LSM7 293 Cell Lysate | +Inquiry |
THPO-2273CCL | Recombinant Cynomolgus THPO cell lysate | +Inquiry |
OAS3-3613HCL | Recombinant Human OAS3 293 Cell Lysate | +Inquiry |
IZUMO1-1248HCL | Recombinant Human IZUMO1 cell lysate | +Inquiry |
PRY-510HCL | Recombinant Human PRY lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B3GALT13 Products
Required fields are marked with *
My Review for All B3GALT13 Products
Required fields are marked with *
0
Inquiry Basket