Recombinant Full Length Arabidopsis Thaliana Peroxisomal Membrane Protein Pex14(Pex14) Protein, His-Tagged
Cat.No. : | RFL14550AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Peroxisomal membrane protein PEX14(PEX14) Protein (Q9FXT6) (1-507aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-507) |
Form : | Lyophilized powder |
AA Sequence : | MATHQQTQPPSDFPALADENSQIPEATKPANEVQQATIAQDPPTSVFKNSEPIREDQIQN AIKFLSHPRVRGSPVIHRRSFLERKGLTKEEIDEAFRRVPDPPPSSQTTVTTSQDGQQAV STVQPQAMQPVVAAPAPLIVTPQAAFLSRFRWYHAILAVGVLAASGAGTAVFIKRSLIPR FKSWVQRIMLEEETDPLKKADAKPSLAEEAVAAAKAASAAASDVARVSQEMMITKNEERK YFEDLTHLLGVQVQEMKSLSNNIRKLEGQSNNIPKIYSADQEVYNGSVTTARKPYTNGSN VDYDTRSARSASPPAAPADSSAPPHPKSYMDIMSMIQRGEKPSNIREINDMPPNPNQPLS DPRIAPKSKPWDYGQAPQDESSNGQWWQQKNPRSTDFGYETTTAARFTANQNETSTMEPA AFQRQRSWVPPQPPPVAMAEAVEAIRRPKPQAKIDQEAAASDGQSGVSDELQKITKFSES GGDGSGGIKIAEIQEETEQQHISQEGN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PEX14 |
Synonyms | PEX14; PED2; At5g62810; MQB2.13; Peroxisomal membrane protein PEX14; Peroxin-14; AtPEX14; Peroxisome biogenesis protein 14; Pex14p; Protein PEROXISOME DEFECTIVE 2 |
UniProt ID | Q9FXT6 |
◆ Recombinant Proteins | ||
RFL14550AF | Recombinant Full Length Arabidopsis Thaliana Peroxisomal Membrane Protein Pex14(Pex14) Protein, His-Tagged | +Inquiry |
Pex14-4796M | Recombinant Mouse Pex14 Protein, Myc/DDK-tagged | +Inquiry |
PEX14-4042R | Recombinant Rat PEX14 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEX14-3614H | Recombinant Human PEX14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PEX14-1071H | Recombinant Human PEX14 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEX14-1336HCL | Recombinant Human PEX14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PEX14 Products
Required fields are marked with *
My Review for All PEX14 Products
Required fields are marked with *
0
Inquiry Basket