Recombinant Full Length Arabidopsis Thaliana Peptidyl-Prolyl Cis-Trans Isomerase Pasticcino1(Pas1) Protein, His-Tagged
Cat.No. : | RFL135AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Peptidyl-prolyl cis-trans isomerase PASTICCINO1(PAS1) Protein (Q7DMA9) (1-635aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-635) |
Form : | Lyophilized powder |
AA Sequence : | MAVGDQTEQNYLPKKKKSETEDDKRRKKIVPGSLLKAVVRPGGGDSSPVDGDQVIYHCTV RTLDGVVVESTRSESGGRGVPIRDVLGNSKMILGLLEGIPTMHKGEIAMFKMKPEMHYAE IDCPVSAPENFPKDDELHFEIELLDFSKAKIASDDLGVIKKILNEGEGWESPREPYEVKA RISAKSGDGHVIFSHTEEPYFFTFGKSEVPKGLEIGIGTMARKEKAVIYVRKQYLTESPL LHIDQDLEEVHFEVELVHFIQVRDMLGDGRLIKRRIRDGRGEFPMDCPLQDSRLSVHYKG MLLNEEKTVFYDSKIDNNDQPLEFSSGEGLVPEGFEMCTRLMLPGEIALVTCPPDYAYDK FPRPPGVSEGAHVQWEIELLGFETPRDWTGLNFQSIMDEADKIRSTGNRLFKEGKFELAK AKYEKVLREFNHVNPQDEDEGKIFGDTRNMLHLNVAACLLKMGEWRKSIETCNKVLEAKP GHVKGLYRRGMAYIAGGEYDDARNDFNMMIKVDKSSEADATAALLKLKQKEQEAESKARK QFKGLFDKRPGEITEVGSEIREESKTIEEVDETKDNDDDETLEEEGATTVSTERKRKWSE KAWPFLKNVMLQIGIQLGVVLIGILIFQFVSAKFT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PAS1 |
Synonyms | PAS1; DEI1; FKBP70; FKBP72; At3g54010; F5K20.310; Peptidyl-prolyl cis-trans isomerase PASTICCINO1; 70 kDa peptidyl-prolyl isomerase; FK506-binding protein 72; AtFKBP72; Immunophilin FKBP72; Peptidyl-prolyl cis-trans isomerase FKBP72; PPIase FKBP72; Rotama |
UniProt ID | Q7DMA9 |
◆ Native Proteins | ||
Avidin Biotin-27 | Native Avidin Protein | +Inquiry |
TF-143C | Native Chicken Serum Transferrin | +Inquiry |
Lectin-1834R | Active Native Ricinus Communis Agglutinin II Protein | +Inquiry |
CAT-75H | Native Human Catalase | +Inquiry |
LRP1-18H | Native Human Intermediate Density Lipoproteins Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNQ4-5017HCL | Recombinant Human KCNQ4 293 Cell Lysate | +Inquiry |
RARRES1-1470HCL | Recombinant Human RARRES1 cell lysate | +Inquiry |
PCLO-1311HCL | Recombinant Human PCLO cell lysate | +Inquiry |
ALKBH5-8900HCL | Recombinant Human ALKBH5 293 Cell Lysate | +Inquiry |
FKBP2-6207HCL | Recombinant Human FKBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAS1 Products
Required fields are marked with *
My Review for All PAS1 Products
Required fields are marked with *
0
Inquiry Basket