Recombinant Full Length Arabidopsis Thaliana Mlo-Like Protein 9(Mlo9) Protein, His-Tagged
Cat.No. : | RFL22173AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana MLO-like protein 9(MLO9) Protein (Q94KB4) (1-460aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-460) |
Form : | Lyophilized powder |
AA Sequence : | MAGGGGGGGGEGPRQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFERKKKKALFEA LEKIKNELMVLGFISLLLTFGQNYIASICVPSRYGHAMSFCGPYDGPSEDDRKKLKKTDH AMRILYSVQRRSLADAPPVNCKKDYVALISLNALHQVHIFIFFLAVFHVIYSAITMMLGR AKIRGWKVWEQEVIHEQEMMNDPSRFRLTHETSFVREHVNSWASNKFFFYVMCFFRQILR SVRKSDYLTMRHGFISVHLAPGMKFDFQKYIKRSLEDDFKVVVGIRPELWAFVMLFLLFD VHGWYVTAVITMIPPLLTLAIGTKLQAIISYMALEIQERHAVIQGMPVVNVSDQHFWFEK PDLVLHMIHFVLFQNAFEITYFFWIWYEFGLRSCFHHHFGLIIIRVCLGVGVQFLCSYIT LPLYALVTQMGSTMKRSVFDEQTSKALEQWHKKARKKNEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MLO9 |
Synonyms | MLO9; At1g42560; F8D11.2; T8D8.5; MLO-like protein 9; AtMlo9 |
UniProt ID | Q94KB4 |
◆ Native Proteins | ||
PNLIP-8205H | Native Human Pancreas Lipase | +Inquiry |
Collagen Type I & III-08R | Native Rat Collagen Type I and III Protein | +Inquiry |
TG-31519TH | Native Human TG | +Inquiry |
Hb-001H | Native Human Hb Protein | +Inquiry |
DIS-2020 | Active Cyclodextrin Glucanotransferase (Powder) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNGA1-7412HCL | Recombinant Human CNGA1 293 Cell Lysate | +Inquiry |
FERD3L-6263HCL | Recombinant Human FERD3L 293 Cell Lysate | +Inquiry |
TIAL1-1779HCL | Recombinant Human TIAL1 cell lysate | +Inquiry |
C6orf136-7995HCL | Recombinant Human C6orf136 293 Cell Lysate | +Inquiry |
NFKBIL1-3847HCL | Recombinant Human NFKBIL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MLO9 Products
Required fields are marked with *
My Review for All MLO9 Products
Required fields are marked with *
0
Inquiry Basket