Recombinant Full Length Arabidopsis Thaliana Mechanosensitive Ion Channel Protein 2, Chloroplastic(Msl2) Protein, His-Tagged
Cat.No. : | RFL34101AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Mechanosensitive ion channel protein 2, chloroplastic(MSL2) Protein (Q56X46) (76-673aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (76-673) |
Form : | Lyophilized powder |
AA Sequence : | CHSFSASGKAIEPAVKAVTVVLTKSHGLMQQFPFVYKLVPAVALLVFSLWGLVPFARQGR NILLNKNDNGWKKSGTYHVMTSYVQPLLLWLGALFICRALDPVVLPTEASKIVKDRLLNF VRSLSTVLAFAYCLSSLIQQTQKLFSETSNPSDTRNMGFQFAGKALYSAVWVAAVSLFME LLGFSTQKWLTAGGLGTVLITLAGREILTNFLSSVMIHATRPFVLNEWIQTKIEGYEVSG TVEHVGWWSPTIIRGEDREAIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINN IVADMRKVLAKNPMVEQQRLHRRVFLENVIPENQALSILISCFVKTSHHEEYLGVKEAIL LDLLRVISHHRARLATPIRTIRKMYTETDVENTPFGESMYGGVTSRRPLMLIEPAYKING EDKSKSQNRAAKPTAEQENKGSNPKSKETSSPDLKANVKVGESPVSDTNKVPEETVAKPV IKAVSKPPTPKDTETSGTEKPKAKRSGGTIKSTKTDETDSSTSSASRSTLEENIVLGVAL EGSKRTLPIEEEIHSPPMETDAKELTGARRSGGNGPLVADKEQKDSQSQPNSGASTEP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MSL2 |
Synonyms | MSL2; At5g10490; F12B17.160; Mechanosensitive ion channel protein 2, chloroplastic; Mechanosensitive channel of small conductance-like 2; MscS-Like protein 2 |
UniProt ID | Q56X46 |
◆ Recombinant Proteins | ||
MSL2-6459HF | Recombinant Full Length Human MSL2 Protein, GST-tagged | +Inquiry |
MSL2-5743M | Recombinant Mouse MSL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSL2-83H | Recombinant Human MSL2, His-tagged | +Inquiry |
MSL2-2694R | Recombinant Rhesus Macaque MSL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MSL2-5656H | Recombinant Human MSL2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSL2-4114HCL | Recombinant Human MSL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSL2 Products
Required fields are marked with *
My Review for All MSL2 Products
Required fields are marked with *
0
Inquiry Basket