Recombinant Full Length Arabidopsis Thaliana Magnesium Transporter Mrs2-8(Mrs2-8) Protein, His-Tagged
Cat.No. : | RFL15083AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Magnesium transporter MRS2-8(MRS2-8) Protein (P0CZ21) (1-380aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-380) |
Form : | Lyophilized powder |
AA Sequence : | MLPNEELVPVKRITPQSSWSWISIDATGKKTVLDVDKYVIMHRVQIHARDLRILDPNLFY PSAILGRERAIVLNLEHIKAIITAKEVLIQDSSDENLIPTLEEFQTRLSVGNKAHGGQLD GDVVEEDESAFEFRALEVALEAICSFLAARTIELEKSAYPALDELTLKLTSRNLLRVCKL KSSMTRLTAQVQKIKDELEQLLEDDEDMAELYLSRKLAGASSPAIDSGEHINWYPTSPTI GAKISRAKSHLVRSATVRGDDKNDVEEVEMLLEAHFMQIDRTLNKLTELREYVDETEDFL NIQLDSSRNQLIKFEIILTAGSICVSVYSVVVGILGMNIPFPWNIKKHMFKWVVSGTATV CAILFVTIMSFARYKKLFGF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-8 |
Synonyms | MRS2-8; MGT8; Magnesium transporter MRS2-8; Magnesium Transporter 8; AtMGT8 |
UniProt ID | P0CZ21 |
◆ Native Proteins | ||
C6-101H | Native Human C6 Protein | +Inquiry |
ICDH-209S | Active Native Swine Isocitrate Dehydrogenase | +Inquiry |
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
KLH-82 | Native Hemocyanin-Keyhole Limpet (KLH) subunits | +Inquiry |
T.gondii-39 | Native Toxoplasma gondii Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
C14orf169-206HCL | Recombinant Human C14orf169 cell lysate | +Inquiry |
GPR1-736HCL | Recombinant Human GPR1 cell lysate | +Inquiry |
SERPINB2-652HCL | Recombinant Human SERPINB2 cell lysate | +Inquiry |
ISY1-5142HCL | Recombinant Human ISY1 293 Cell Lysate | +Inquiry |
MPV17-4222HCL | Recombinant Human MPV17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2-8 Products
Required fields are marked with *
My Review for All MRS2-8 Products
Required fields are marked with *
0
Inquiry Basket