Recombinant Full Length Arabidopsis Thaliana Magnesium Transporter Mrs2-4(Mrs2-4) Protein, His-Tagged
Cat.No. : | RFL25979AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Magnesium transporter MRS2-4(MRS2-4) Protein (Q93ZD7) (1-436aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-436) |
Form : | Lyophilized powder |
AA Sequence : | MGKGPLSFRRLSSIRHRKKGSAVKDDSAQTSTPSSPPPPLPIHAGGSAVGATGKAKKKTG GARLWMRFDRTGAMEVVECDKSTIIKRASVPARDLRILGPVFSHSSNILAREKAIVVNLE VIKAIVTAEEVLLLDPLRPEVLPFVERLKQQFPQRNGNENALQASANVQSPLDPEAAEGL QSELPFEFQVLEIALEVVCSFVDKSVAALETEAWPVLDELTKNVSTENLEYVRSLKSNLT RLLARVQKVRDELEHLLDDNEDMADLYLTRKWIQNQQTEAILAGTASNSIALPAHNTSNL HRLTSNRSASMVTSNTEEDDVEDLEMLLEAYFMQLDGMRNKILTVREYIDDTEDYVNIQL DNQRNELIQLQLTLTIASFAIAAETLLASLFGMNIPCPLYSIHGVFGYFVWSVTALCIVL FMVTLGYARWKKLLGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-4 |
Synonyms | MRS2-4; MGT6; At3g58970; F17J16.20; Magnesium transporter MRS2-4; Magnesium Transporter 6; AtMGT6 |
UniProt ID | Q93ZD7 |
◆ Recombinant Proteins | ||
FOXA3-151H | Active Recombinant Human FOXA3(T58A) protein, Arginine-tagged | +Inquiry |
SUN1-8873M | Recombinant Mouse SUN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IDE-117H | Recombinant Human IDE, His-tagged | +Inquiry |
SERPINA12-3931H | Active Recombinant Human SERPINA12 Full Length protein, His-tagged | +Inquiry |
UBE2D4-851H | Recombinant Human UBE2D4 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PIV3-20 | Native Parainfluenza Virus Type 3 Antigen | +Inquiry |
LDL-400H | Native Human Low Density Lipoprotein, High Oxidized | +Inquiry |
imALB-36H | Native Human Ischemia Modified Albumin (IMA) Protein | +Inquiry |
COL4A1-001H | Native Human COL4A1 Protein | +Inquiry |
Troponin I-12H | Native Human Troponin I protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT1H-4100HCL | Recombinant Human MT1H 293 Cell Lysate | +Inquiry |
ZFYVE20-175HCL | Recombinant Human ZFYVE20 293 Cell Lysate | +Inquiry |
SEPT6-1954HCL | Recombinant Human SEPT6 293 Cell Lysate | +Inquiry |
CDH17-2032HCL | Recombinant Human CDH17 cell lysate | +Inquiry |
RUNDC3B-573HCL | Recombinant Human RUNDC3B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2-4 Products
Required fields are marked with *
My Review for All MRS2-4 Products
Required fields are marked with *
0
Inquiry Basket