Recombinant Full Length Arabidopsis Thaliana Magnesium Transporter Mrs2-1(Mrs2-1) Protein, His-Tagged
Cat.No. : | RFL29811AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Magnesium transporter MRS2-1(MRS2-1) Protein (Q9S9N4) (1-442aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-442) |
Form : | Lyophilized powder |
AA Sequence : | MSELKERLLPPRPASAMNLRDASVTRPSASGRPPLLGVDVLGLKKRGQGLRSWIRVDTSG NTQVMEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITADEVL LLNSLDNYVLRYVVELQQRLKTSSVGEMWQQENSQLSRRRSRSFDNAFENSSPDYLPFEF RALEIALEAACTFLDSQASELEIEAYPLLDELTSKISTLNLERVRRLKSRLVALTRRVQK VRDEIEQLMDDDGDMAEMYLTEKKRRMEGSMYGDQSLLGYRSNDGLSVSAPVSPVSSPPD SRRLDKSLSIARSRHDSARSSEGAENIEELEMLLEAYFVVIDSTLNKLTSLKEYIDDTED FINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFEIDFFNQPGAFRWVLIITG VCGFVIFSAFVWFFKYRRLMPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2-1 |
Synonyms | MRS2-1; MGT2; At1g16010; T24D18.11; Magnesium transporter MRS2-1; Magnesium Transporter 2; AtMGT2 |
UniProt ID | Q9S9N4 |
◆ Recombinant Proteins | ||
ITFG3-2312R | Recombinant Rhesus monkey ITFG3 Protein, His-tagged | +Inquiry |
ERBB4-288HAF488 | Recombinant Human ERBB4 Protein, Fc/His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
HSPA1A-066H | Active Recombinant Human HSPA1A Protein, His-tagged | +Inquiry |
EPOR-3851H | Recombinant Human EPOR protein(25-250aa), His-tagged | +Inquiry |
RAB39A-573H | Recombinant Human RAB39A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
CYCS-17B | Native Bovine Cytochrome C Protein | +Inquiry |
Tryptase-01H | Active Native Human Tryptase Protein | +Inquiry |
Lectin-1725W | Native Wheat Germ Lectin | +Inquiry |
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
FABP-177R | Native Rabbit Fatty acid Binding Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TACO1-1284HCL | Recombinant Human TACO1 293 Cell Lysate | +Inquiry |
C1orf216-8165HCL | Recombinant Human C1orf216 293 Cell Lysate | +Inquiry |
FMO4-6182HCL | Recombinant Human FMO4 293 Cell Lysate | +Inquiry |
TNFRSF10B-2829HCL | Recombinant Human TNFRSF10B cell lysate | +Inquiry |
TAS1R3-1247HCL | Recombinant Human TAS1R3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2-1 Products
Required fields are marked with *
My Review for All MRS2-1 Products
Required fields are marked with *
0
Inquiry Basket