Recombinant Human RAB39A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RAB39A-573H |
Product Overview : | RAB39 MS Standard C13 and N15-labeled recombinant protein (NP_059986) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in vesicular trafficking. Plays a role in the fusion of phagosomes with lysosomes. Negatively regulates LPS-induced autophagosome formation in macrophages possibly by implicating PI3K. May be involved in multiple neurite formation. |
Molecular Mass : | 25 kDa |
AA Sequence : | METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RAB39A RAB39A, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB39A |
Synonyms | RAB39A; RAB39A, member RAS oncogene family; RAB39; ras-related protein Rab-39A; RAB39, member RAS oncogene family; rab-39; rab-related GTP-binding protein |
Gene ID | 54734 |
mRNA Refseq | NM_017516 |
Protein Refseq | NP_059986 |
UniProt ID | Q14964 |
◆ Recombinant Proteins | ||
RAB39A-573H | Recombinant Human RAB39A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB39A-1453HCL | Recombinant Human RAB39A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB39A Products
Required fields are marked with *
My Review for All RAB39A Products
Required fields are marked with *
0
Inquiry Basket