Recombinant Full Length Arabidopsis Thaliana Kelch Repeat-Containing Protein At3G27220(At3G27220) Protein, His-Tagged
Cat.No. : | RFL2637AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Kelch repeat-containing protein At3g27220(At3g27220) Protein (Q9LK31) (1-426aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-426) |
Form : | Lyophilized powder |
AA Sequence : | MANKPDHHHHHHQSSRRLMLVLYFTSVLGIGFIAAFLCLSSSIPSVSAVFSIWVPVNRPE IQIPIIDSKIVQKRSKQSNDTKDHVRFLSAIFADIPAPELKWEEMESAPVPRLDGYSVQI NNLLYVFSGYGSLDYVHSHVDVFNFTDNKWCDRFHTPKEMANSHLGIVTDGRYVYVVSGQ LGPQCRGPTSRSFVLDSFTKTWLEFPSLPAPRYAPATQIWRGRLHVMGGSKENRNAVAFD HWSIAVKDGKALDEWREEVPIPRGGPHRACVVANDKLLVIGGQEGDFMAKPNSPIFKCSR RREIFNGEVYMMDEEMKWKMLPPMPKNNSHIESAWIIVNNSIVIVGGTTDWHPVTKRLVL VGEIFRFQLDTLTWSVIGRLPYRVKTAMAGFWNGYLYFTSGQRDRGPDNPQPGKVIGEMW RTKLKF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | At3g27220 |
Synonyms | At3g27220; K17E12.4; Kelch repeat-containing protein At3g27220 |
UniProt ID | Q9LK31 |
◆ Recombinant Proteins | ||
HLA-DRB3-13823H | Recombinant Human HLA-DRB3, His-tagged | +Inquiry |
CDCA3-772R | Recombinant Rhesus monkey CDCA3 Protein, His-tagged | +Inquiry |
CD2AP-0933H | Recombinant Human CD2AP Protein (Thr149-Glu429), N-His tagged | +Inquiry |
CSN1S1-1666H | Recombinant Human CSN1S1 protein, His-tagged | +Inquiry |
CSF2RA-1970H | Recombinant Human CSF2RA Protein | +Inquiry |
◆ Native Proteins | ||
LDL-396H | Native Human Low Density Lipoprotein, DiI labeled | +Inquiry |
NTF3-29249TH | Native Human NTF3 | +Inquiry |
CPB2-27270TH | Native Human CPB2 | +Inquiry |
CA-50-381H | Active Native Human Cancer Antigen 50 | +Inquiry |
Ferritin-025B | Native Bovine Ferritin Protein, apo-form | +Inquiry |
◆ Cell & Tissue Lysates | ||
C21orf56-8100HCL | Recombinant Human C21orf56 293 Cell Lysate | +Inquiry |
KYNU-526MCL | Recombinant Mouse KYNU cell lysate | +Inquiry |
VGLL2-1904HCL | Recombinant Human VGLL2 cell lysate | +Inquiry |
ANKS3-26HCL | Recombinant Human ANKS3 lysate | +Inquiry |
BRIX1-8407HCL | Recombinant Human BRIX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All At3g27220 Products
Required fields are marked with *
My Review for All At3g27220 Products
Required fields are marked with *
0
Inquiry Basket