Recombinant Full Length Arabidopsis Thaliana Cbs Domain-Containing Protein Cbscbspb4(Cbscbspb4) Protein, His-Tagged
Cat.No. : | RFL6024AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana CBS domain-containing protein CBSCBSPB4(CBSCBSPB4) Protein (Q0WLC7) (1-548aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-548) |
Form : | Lyophilized powder |
AA Sequence : | MANQGGPSRKSLSFSGHSFQGRKKASENEGGGGGGSDLLPRRSLTSSRSSISLSGERSGE RTVKRLRLCKALTVPDSTTLFEACRRMAARRVDALLLTDSNALLCGILTDRDIATKVIAK QLNLEETPVSKVMTKNPVFVLSDTIAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLY DAIARMERSVEKGKAIAAAVEGVEKNWGTSIAGPNTFMETLRERIFKPSLSTIIPENTKV LKVGLDETVLGVTMKMVEYQSSAAMVMVENKLVGILTSKDILMRVISQNLPQETTTVEKV MTPNPESATVDMAIVEALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAVTTAGSTAG INNETANSMMQKFWDSAMALSPNEDGDETRSEEESMKLSSEIEVTKSFSYPNTFAFKLQD KKGRMHRFMCETQSLTTLITAILQRMGDDIEPDNLPQIMYEDEDNDKVVLASDNDLGAAV EHAKSIGWKGLKLHLDYTEERGHRRGLSSEDMDYDQSNSWAAAYKTVAAGAALAAGLGVL VYLKRNSN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CBSCBSPB4 |
Synonyms | CBSCBSPB4; At5g50530; MBA10.9; CBS domain-containing protein CBSCBSPB4 |
UniProt ID | Q0WLC7 |
◆ Recombinant Proteins | ||
ARHGAP17B-6493Z | Recombinant Zebrafish ARHGAP17B | +Inquiry |
MLEC-5578M | Recombinant Mouse MLEC Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNF207-5123R | Recombinant Rhesus Macaque ZNF207 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPLP1-3815R | Recombinant Rhesus Macaque RPLP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LTK-4586H | Active Recombinant Human LTK Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
Apotransferrin-37D | Native dog Apotransferrin | +Inquiry |
Fga-299M | Active Native Mouse Fibrinogen | +Inquiry |
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RAPL1-2740HCL | Recombinant Human IL1RAPL1 Overexpression Lysate | +Inquiry |
PLAU-1734HCL | Recombinant Human PLAU cell lysate | +Inquiry |
GPM6B-304HCL | Recombinant Human GPM6B lysate | +Inquiry |
SPRYD4-1488HCL | Recombinant Human SPRYD4 293 Cell Lysate | +Inquiry |
SLPI-001HCL | Recombinant Human SLPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CBSCBSPB4 Products
Required fields are marked with *
My Review for All CBSCBSPB4 Products
Required fields are marked with *
0
Inquiry Basket