Recombinant Full Length Arabidopsis Thaliana Cbs Domain-Containing Protein Cbscbspb2(Cbscbspb2) Protein, His-Tagged
Cat.No. : | RFL1470AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana CBS domain-containing protein CBSCBSPB2(CBSCBSPB2) Protein (Q9SJQ5) (1-536aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-536) |
Form : | Lyophilized powder |
AA Sequence : | MTTTPTSSGRRSISSIRRTSSASKKPVLQSEESESGSGSINENTSKPDSPLAQPVSDGER TVKKLRLSKALTINEGTTVFDACRRMAARRVDAVLLTDSSALLSGIVTDKDIATRVIAEG LRPEHTLVSKVMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIALLDITKCLYD AISRMEKAAEQGSALATAVEERHWGSGNFAFIDTLRERMFKPALSTIVTENTKVALVSAS DPVFVASKKMRDLRVNSVIIAVGNKIHGILTSKDILMRVVAQNLSPELTLVEKVMTPNPE CASIETTILDALHIMHDGKFLHLPVFDKDGFAVACLDVLQITHAAISTVENNSSGAVNDM ANTMMQKFWDSALALEPPEDYETHSDMSAMLINSEGKQSCPSQGLVSSFAFKFEDRKGRV QRFNSTGESFEELMSVVMQRCEADSGLQIMYQDDEGDKVLISRDSDLVAAVTFARSLGQK VLRLHLDFTETIAPLETIADLSEGNGGCVWWQTGVLAGAIVLTSIGLFVYLKRSKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CBSCBSPB2 |
Synonyms | CBSCBSPB2; At2g36500; F1O11.13; CBS domain-containing protein CBSCBSPB2 |
UniProt ID | Q9SJQ5 |
◆ Native Proteins | ||
GABase-01P | Native Pseudomonas fluorescens γ-aminobutyric acid amino transferase, Tag Free | +Inquiry |
Streptolysin-171S | Native Streptolysin O protein | +Inquiry |
Immunoglobulin G3-83H | Native Human Immunoglobulin G3 | +Inquiry |
Thermolysin | Native Geobacillus stearothermophilus Thermolysin Protein | +Inquiry |
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
APCDD1L-8799HCL | Recombinant Human APCDD1L 293 Cell Lysate | +Inquiry |
CNTN5-3032HCL | Recombinant Human CNTN5 cell lysate | +Inquiry |
TXNRD1-1866HCL | Recombinant Human TXNRD1 cell lysate | +Inquiry |
LRPPRC-4652HCL | Recombinant Human LRPPRC 293 Cell Lysate | +Inquiry |
REG4-001HCL | Recombinant Human REG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CBSCBSPB2 Products
Required fields are marked with *
My Review for All CBSCBSPB2 Products
Required fields are marked with *
0
Inquiry Basket