Recombinant Full Length Syntrophomonas Wolfei Subsp. Wolfei Upf0316 Protein Swol_0526(Swol_0526) Protein, His-Tagged
Cat.No. : | RFL22848SF |
Product Overview : | Recombinant Full Length Syntrophomonas wolfei subsp. wolfei UPF0316 protein Swol_0526(Swol_0526) Protein (Q0AZJ4) (1-168aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Syntrophomonas wolfei subsp. wolfei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-168) |
Form : | Lyophilized powder |
AA Sequence : | MLFELIFIFLARVLDVSLGTVRMILVIRGDRIPAAIIGFFEILIYTVALGLVIGSLNEPL KLLVFCSGFALGILLGSILEEKIALGYRGVQVTIDSEHGHIVEELREEGFPVTCWEASGK AGSKLVLNIFLKRNMAVAVADKIYEKDPDAFVVFMEPKHFQGGYIKKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Swol_0526 |
Synonyms | Swol_0526; UPF0316 protein Swol_0526 |
UniProt ID | Q0AZJ4 |
◆ Recombinant Proteins | ||
PTPRS-301542H | Recombinant Human PTPRS protein, GST-tagged | +Inquiry |
RFL20594SF | Recombinant Full Length Scheffersomyces Stipitis Golgi Apparatus Membrane Protein Tvp23(Tvp23) Protein, His-Tagged | +Inquiry |
MPXV-0702 | Recombinant Monkeypox Virus Protein, DNA ligase | +Inquiry |
GMPR-2790Z | Recombinant Zebrafish GMPR | +Inquiry |
RFL18446MF | Recombinant Full Length Mouse Bri3-Binding Protein(Bri3Bp) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Chymotrypsin-163B | Active Native Bovine Chymotrypsin | +Inquiry |
Hb-117M | Native Mouse Hb | +Inquiry |
IGHE -22H | Native Human IgE | +Inquiry |
PRL-8245H | Native Human Prolactin | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLC4-938HCL | Recombinant Human KLC4 cell lysate | +Inquiry |
FBXL5-6310HCL | Recombinant Human FBXL5 293 Cell Lysate | +Inquiry |
CDC16-7670HCL | Recombinant Human CDC16 293 Cell Lysate | +Inquiry |
GNLY-5845HCL | Recombinant Human GNLY 293 Cell Lysate | +Inquiry |
SLU7-1679HCL | Recombinant Human SLU7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Swol_0526 Products
Required fields are marked with *
My Review for All Swol_0526 Products
Required fields are marked with *
0
Inquiry Basket